Code2MCP: A Multi-Agent Framework for Automated Transformation of Code Repositories into Model Context Protocol Services

Abstract

The proliferation of Large Language Models (LLMs) has created a significant integration challenge in the AI agent ecosystem, often called the "$N\times M$ problem," where N models require custom integrations for M tools. This fragmentation stifles innovation and creates substantial development overhead. While the Model Context Protocol (MCP) has emerged as a standard to resolve this, its adoption is hindered by the manual effort required to convert the vast universe of existing software into MCP-compliant services. This is especially true for the millions of open-source repositories on GitHub, the world’s largest collection of functional code. This paper introduces Code2MCP, a highly automated, agentic framework designed to transform any GitHub repository into a functional MCP service with minimal human intervention. Our system employs a multi-stage workflow that automates the entire process, from code analysis and environment configuration to service generation and deployment. A key innovation of our framework is an LLM-driven, closed-loop "Run–Review–Fix" cycle, which enables the system to autonomously debug and repair the code it generates. Code2MCP produces not only deployable services but also comprehensive technical documentation, acting as a catalyst to accelerate the MCP ecosystem by systematically unlocking the world’s largest open-source code repository and automating the critical last mile of tool integration. The code is open-sourced at https://github.com/DEFENSE-SEU/MCP-Github-Agent.

1 Introduction

Figure 1: Overview of the Code2MCP framework. The system takes a GitHub repository URL as input and automatically generates a complete MCP service through a multi-agent workflow.

The landscape of artificial intelligence is increasingly defined by autonomous agents that leverage Large Language Models (LLMs) to interact with external tools wang2024survey . To overcome the inherent limitations of LLMs in tasks requiring real-time information or precise computation, the paradigm of "tool-augmented reasoning" has become central huang2024understanding . Seminal works have demonstrated that models can effectively learn to invoke external functions schickToolformerLanguageModels2023 ; qinToolLLMFacilitatingLarge2023 ; patilGorillaLargeLanguage2023 ; parisiTALMToolAugmented2022 . However, this burgeoning ecosystem faces a fundamental scalability challenge: the "$N\times M$" integration problem liAPIBankComprehensiveBenchmark2023a ; liangTaskMatrixAICompletingTasks2023 ; qinToolLLMFacilitatingLarge2023 ; anthropic2023mcp . Each of the N models or agent applications often requires a bespoke connector for each of the M tools it must access. This results in a fragmented and inefficient system where development effort is duplicated and innovation is stifled by high integration costs quToolLearningLarge2025 ; shenLLMToolsSurvey2024 .

To address this complexity, the Model Context Protocol (MCP) has been proposed as a systemic solution anthropic2023mcp . Analogous to USB-C for hardware, MCP provides a standardized interface for tools to expose their capabilities. It is a client-server specification based on JSON-RPC 2.0, defined by three core primitives. These include Tools, which are the executable functions an agent can invoke, each defined by a name, description, and JSON schemas for inputs and outputs; Resources, which represent addressable data sources like files or database entries that the agent can access; and Prompts, which are reusable, templated workflows provided by the server to guide an agent’s reasoning. By decoupling a tool’s implementation from the agent’s logic, MCP fosters an ecosystem of reusable and interoperable components yue2025autonomous .

Despite its transformative potential, the growth of the MCP ecosystem is fundamentally constrained by a "last-mile" adoption bottleneck: the immense manual labor required to wrap existing software libraries into MCP-compliant services. The root of this challenge lies in a basic mismatch: most high-value software libraries are developer-friendly but not agent-friendly, with documentation and interfaces designed for human interpretation yue2025foam ; yue2024clinicalagent . This bottleneck effectively locks away the world’s largest and most dynamic collection of software, GitHub, preventing its direct integration into the emerging agent economy. This paper is the first to systematically address this adoption gap.

To solve this last-mile problem, we introduce Code2MCP, an agentic framework that automates this entire conversion process. By design, Code2MCP takes a GitHub repository URL as its sole input and produces a complete, functional, and documented MCP service as its output. Our primary contribution is an end-to-end system that dramatically lowers the barrier for countless open-source projects to join the MCP ecosystem.

As illustrated in Figure 1, Code2MCP implements a sophisticated multi-stage workflow that transforms any GitHub repository into a functional MCP service. The framework operates through a series of interconnected stages, each designed to handle specific aspects of the conversion process. This systematic approach ensures that the generated services are not only functional but also well-documented and maintainable.

Code2MCP belongs to the growing field of autonomous agents for software engineering but distinguishes itself through its specialized focus. Unlike general-purpose agents such as Devin cognition_devin or those benchmarked on SWE-bench jimenezSWEbenchCanLanguage2024 ; yangSWEagentAgentComputerInterfaces2024 that aim to solve arbitrary coding tasks, Code2MCP executes a well-defined and repeatable engineering pipeline. Our approach draws inspiration from multi-agent collaborative systems like Camel li2023camel , MetaGPT hongMetaGPTMetaProgramming2024 , ChatDev qianChatDevCommunicativeAgents2024 , and frameworks like AutoGen wuAutoGenEnablingNextGen2023 , which show that assigning distinct roles to agents can effectively tackle complex software projects li2023camel . Our contribution applies these principles to a focused problem domain, yielding significant gains in reliability and predictability.

Architecturally, Code2MCP is implemented as a state graph, a robust paradigm for orchestrating complex workflows, influenced by frameworks like LangGraph langgraph2024 . In this model, nodes represent agents or tools, and edges represent transitions, with a shared state object passed between them. This state-graph pattern offers a more deterministic and controllable alternative to purely conversational agent architectures, which can struggle with structured engineering tasks wenBenchmarkingComplexInstructionFollowing2024 ; pressMeasuringNarrowingCompositionality2023 . The structure is ideal for our task, as it naturally accommodates the conditional logic, iteration, and bounded retries essential for our "Run-Review-Fix" self-healing cycle for autonomous debugging harelStatechartsVisualFormalism1987 . This aligns with research demonstrating that structured, decomposed prompting methods improve task completion in complex domains wangPlanandSolvePromptingImproving2023 ; khotDecomposedPromptingModular2023 .

The key contributions of this work are:

• The identification and formalization of the repository-to-service conversion challenge as the primary bottleneck for MCP adoption, and the proposal of Code2MCP as the first systematic framework to address it.

• The design and implementation of a robust, seven-stage automated workflow, orchestrated by a collaborative multi-agent system, to handle the end-to-end conversion process.

• The effective integration of an LLM-driven, "Run-Review-Fix" cycle for autonomous debugging, which significantly enhances the reliability and success rate of the automated conversion process.

• A scalable solution poised to catalyze the MCP ecosystem by programmatically onboarding the vast library of open-source tools on GitHub for the next generation of AI agents.

2 Methodology: The Code2MCP Framework

To automate the conversion of code repositories into MCP services, we designed Code2MCP, a multi-agent framework architected as a state-driven graph. This section details the system’s architecture, the formal problem it addresses, its multi-stage conversion pipeline, and the core principles that guide its operation.

2.1 Overview and System Architecture

The Code2MCP framework is implemented as a directed state graph using the LangGraph library. This architecture is particularly well-suited for complex software engineering tasks as it provides robust control flow, modularity, and traceability. A central orchestrator manages the progression of a shared state object through a series of nodes. This state object acts as a dynamic data bus, accumulating artifacts, metadata, and intermediate results from each stage. The nodes in the graph correspond to the distinct stages of the conversion workflow, enabling conditional logic and iterative cycles, which are crucial for the system’s autonomous debugging capabilities.

2.2 Problem Formulation

Given a repository $\mathcal{R}$, the goal is to synthesize an MCP service $\mathcal{S}$ comprising a set of tools $\{t_{i}\}$ with natural-language descriptions and input/output schemas, example-first documentation, a smoke-test harness, and machine-readable summaries, such that (i) $\mathcal{S}$ is protocol-compliant and instantiable, (ii) $\mathcal{S}$ exposes stable, high-value functionality suitable for agent composition, and (iii) the edit set $E$ to $\mathcal{R}$ satisfies a minimal necessary edits constraint: $E$ is empty unless contract reconciliation requires a localized adjustment at adapter boundaries, in which case $E$ is evidence-backed and fully auditable.

2.3 The Seven-Stage Conversion Pipeline

Algorithm 1 Code2MCP: state-driven conversion with Run–Review–Fix

1: Input: repository URL $u$

2: Download workspace; build isolated env

3: Analysis: LLM analysis + project info $\rightarrow$ plan $\pi$ and candidates

4: Generate: synthesize mcp_service.py, adapter.py, tests, docs

5: $r\leftarrow 0$; $success\leftarrow\mathrm{false}$

6: while $\neg success\;\wedge\;r<B$ do

7:  Run: execute tests; collect traces $\tau$

8:  if tests pass then

9:   $success\leftarrow\mathrm{true}$

10:  else

11:   Review: LLM analyze $\tau$ and propose minimal edit $\delta$ at adapter boundary

12:   Apply $\delta$; update diffs and provenance; refine docs/examples

13:   Regenerate: synthesize updated mcp_service.py, adapter.py, tests, docs

14:   $r\leftarrow r+1$

15:  end if

16: end while

17: Finalize: emit artifacts (mcp_output/), schemas, README, logs

18: Output: ready-to-run, protocol-compliant MCP service

The end-to-end conversion process, outlined in Algorithm 1, is executed through seven specialized nodes within our state graph. Each node is powered by a combination of conventional software tools and dedicated LLM-powered agents. While presented sequentially for clarity, the Generate, Run, and Review nodes form a conditional, iterative loop to enable autonomous error correction, with the central state object preserving the context and history of each attempt.

Download

This initial node handles the repository acquisition and workspace preparation. It clones the target GitHub repository, extracts the source code, and prepares the local workspace for analysis. The node ensures proper authentication and handles various repository access scenarios, including public repositories, private repositories with appropriate credentials, and specific branch or commit targets.

Analysis

This initial node acts as the system’s planner. The Code Analysis Expert agent performs static analysis on the repository’s file tree and ingests project metadata. Its primary output is an analysis.json report, which serves as a strategic blueprint identifying candidate functions and modules for conversion, guiding all subsequent stages.

Environment

To ensure reproducibility, this node creates an isolated environment. It locates dependency files (e.g., requirements.txt, pyproject.toml) and uses Conda or Venv to build the environment. A critical smoke test—attempting to import the project’s main package—verifies environment integrity before proceeding.

Generate

This is the synthesis core of the workflow. The Code Generation Expert agent, guided by the analysis.json blueprint, creates the complete set of MCP service files: mcp_service.py, adapter.py for interfacing with the original code, and test_mcp_basic.py for validation.

Run

This node executes the generated test_mcp_basic.py script within the isolated environment. This smoke test validates that the MCP service can be instantiated without fundamental errors. The outcome of this node determines the workflow’s next transition: on success, the process proceeds to the Finalize node; on failure, it captures the full stdout and stderr traces and routes the workflow to the Review node for diagnosis.

Review

If the Run node reports a failure, this diagnostic node is activated. The Senior Software Engineer / Code Fixer agent analyzes the captured error traceback to determine the root cause (e.g., ImportError, SyntaxError) and generates a targeted correction. Crucially, instead of proceeding linearly, the workflow is then routed back to re-initiate the cycle, starting with the application of the fix. This iterative Generate-Run-Review loop continues until the code passes validation or a retry limit is reached.

Finalize

Only after the generated code is successfully validated by the Run node (potentially after several self-healing cycles) does the workflow enter this final stage. Upon successful completion, this node aggregates all artifacts and metadata from the state object. A Technical Documentation Expert agent synthesizes the results into a final report, including a user-facing README_MCP.md, a technical workflow_summary.json, and an auditable diff_report.md. To facilitate seamless integration for the original developers, the framework then programmatically commits all generated files to a new Git branch, typically named main_mcp, and automatically opens a pull request against the original repository, proposing the addition of the new MCP service.

2.4 Guiding Principle: Minimal Necessary Edits and Auditable Provenance

The design of Code2MCP is governed by a strict minimal necessary edits principle. The system’s primary goal is to maintain the integrity of the original codebase by creating a new, self-contained service layer that wraps the target project’s functionality. Edits to the original code are avoided by default. However, when contract reconciliation is required for instance, to handle a type coercion or path resolution issue at the interface between the library and the service, the system may apply a tightly scoped modification. This interface is defined as the adapter boundary. Every modification is programmatically generated and fully documented in a diff_report.md file, which provides a complete rationale–evidence–diff trail. This ensures that all changes are transparent, auditable, and reversible, allowing maintainers to adopt the MCP service without altering their upstream development workflows.

3 Evaluation

To validate the effectiveness of Code2MCP, we conducted an empirical study designed to quantitatively measure its performance across three key dimensions: efficiency in reducing development time, the computational cost of automation, and robustness in handling real-world code. We selected a diverse set of six open-source repositories from GitHub, spanning domains from scientific computing and natural language processing to image generation, to serve as our benchmark suite.

3.1 Core Performance Evaluation: A Quantitative Analysis of Speed and Cost

Our primary claim is that Code2MCP provides an order-of-magnitude improvement in efficiency over the manual process of creating an MCP service. To substantiate this, we benchmarked the end-to-end conversion time and LLM token cost for each repository. The results are compared against the estimated time required for an experienced human developer to perform the same task, which includes understanding the library’s API, writing the wrapper code, implementing the MCP protocol, creating tests, and producing documentation.

The results, summarized in Table 1, reveal a dramatic increase in efficiency. On average, Code2MCP completed the entire conversion process in just 8.3 minutes, a task that would manually require an estimated 2.4 hours. This translates to an average speedup of over 17-fold, fundamentally changing the economics of tool integration for AI agents. Furthermore, the cost of this automation is modest; the average LLM token consumption was approximately 31,800 tokens per repository. This represents a small, one-time investment to permanently unlock a software library’s functionality for the entire agent ecosystem.

Table 1: Efficiency Comparison: Automated conversion with Code2MCP versus manual development. The manual time is an estimate for an experienced developer to complete the full integration lifecycle. The speedup factor is calculated as (manual time in minutes) / (Code2MCP time in minutes).

Repository	Manual Time	Code2MCP Time	Speedup	LLM Cost
	(Est. hours)	(min)	Factor	(Tokens)
googleresearch/esm	2.0 – 3.0	10	$\sim$15x	28.5k
nbiish/calc	2.5 – 3.5	15	$\sim$12x	78.3k
TextBlob/TextBlob	2.0 – 3.0	6	$\sim$25x	24.7k
dateutil/dateutil	1.5 – 2.5	7	$\sim$17x	19.2k
ankane/searchkick	2.0 – 2.5	8	$\sim$17x	18.9k
OlafenwaMoses/ImageAI	2.0 – 3.0	7	$\sim$21x	21.4k
Average	$\sim$2.4	8.3	$\sim$17.8x	31.8k

The aggregate data in Table 1 establishes what our system achieves in terms of performance. To understand how it handles the diverse challenges presented by these repositories, from intricate APIs to common coding errors, we will now conduct a deep dive into two representative cases from our benchmark set: ‘facebookresearch/esm‘ and ‘nbiish/calc‘.

3.2 Case Study Deep Dive: From Complex APIs to Autonomous Repair

These case studies illustrate the mechanisms that underpin the performance metrics reported above, demonstrating the framework’s ability to manage complexity and its robustness through self-healing.

Tackling Complexity: Automating the esm Library

The ‘esm‘ repository, a state-of-the-art library for protein folding, exemplifies the challenge of high implementation complexity. Manually using this library for a standard task like protein structure prediction requires significant boilerplate code to manage model downloads, device placement (CPU/GPU), input tokenization, and output processing, as illustrated in Listing 1. This steep learning curve is a major barrier to adoption for both humans and AI agents.

⬇

1import torch

2import esm

3

4def predict_protein_structure_manual(sequence: str):

5 # 1. Manually load the model and alphabet

6 model, alphabet = esm.pretrained.esmfold_v1()

7 model = model.eval().cuda() # 2. Handle device placement (e.g., GPU)

8

9 # 3. Manually tokenize the sequence

10 with torch.no_grad():

11 tokenized_input = alphabet.get_batch_converter()([("protein", sequence)])

12

13 # 4. Prepare batch inputs and move to device

14 _, _, batch_tokens = tokenized_input

15 batch_tokens = batch_tokens.cuda()

16

17 # 5. Invoke the model with specific parameters

18 output = model(batch_tokens, repr_layers=[33], return_contacts=True)

19

20 # 6. Post-process and save the output to a PDB file

21 pdb_output = model.output_to_pdb(output)[0]

22 with open("predicted_structure.pdb", "w") as f:

23 f.write(pdb_output)

24

25 print("Structure saved to predicted_structure.pdb")

26

27# User must know the exact sequence of steps to execute the prediction

28predict_protein_structure_manual("MKTVRQERLLKISLVLSELPLESKPEPVQGAALQAELLSQVRQDIANSLNAVATRPGYLAGG")

Listing 1: A simplified example of the manual code required to use the original ESM library for structure prediction.

Figure 2: Successful protein structure prediction using the auto-generated ESM MCP service’s agent interface within Claude-Code. The AI agent seamlessly processes a user’s request, demonstrating the end-to-end functionality and simplicity of the converted tool.

Code2MCP automates this entire integration process. As shown in Table 1, the framework completed the conversion in just 10 minutes. It successfully analyzed the repository, identified core functionalities, and generated a fully encapsulated MCP service. This reduces the once-complex workflow to a single, intuitive tool call, as shown in Listing 2. This case demonstrates how our framework’s automated code analysis and synthesis stages effectively abstract away significant domain complexity, which is key to its high efficiency. The final generated service executed flawlessly, as shown in Figure 2.

⬇

1# The AI agent now has access to a simple, high-level tool

2# All complexity of model loading, device management, and I/O is abstracted away.

3

4response = mcp_tools.esm.predict_structure(

5 sequence="MKTVRQERLLKISLVLSELPLESKPEPVQGAALQAELLSQVRQDIANSLNAVATRPGYLAGG"

6)

7

8# The agent receives a structured, easy-to-parse response

9print(response)

10# Expected Output: {’pdb_file_path’: ’/workspace/output/protein.pdb’, ’message’: ’…’}

Listing 2: Invoking the same function through the MCP service generated by Code2MCP.

Ensuring Robustness: The "Run–Review–Fix" Self-Healing Cycle

A critical factor enabling the high success rate across our benchmark set is the framework’s ability to autonomously debug its own generated code. The conversion of the nbiish/calc library provided a textbook example of this "Run–Review–Fix" cycle in action.

• Run: The initial test script generated by the agent failed with an ImportError. The generated adapter.py file used a relative import (from . import utils) that was incompatible with the test execution context.

• Review: The workflow automatically transitioned to the Review stage. The "Code Fixer" agent analyzed the captured error traceback, correctly identifying the root cause as a faulty import path.

• Fix: The agent proposed a minimal, targeted edit: changing the import statement to an absolute path (from calc import utils). This correction was applied, and the relevant service files were regenerated.

On the subsequent run, the tests passed. This entire self-healing loop was completed in under 90 seconds without human intervention, contributing to the final successful conversion time of 15 minutes reported in Table 1. This mechanism is crucial for ensuring robustness, allowing the system to overcome common integration challenges that would otherwise halt an automated process and decrease its overall success rate. The final, auto-repaired service correctly exposed mathematical tools that could be seamlessly used by an AI agent, as shown in Figures 3 and 4.

Figure 3: Demonstration of the math_calc MCP service’s agent interface within Claude-Code. It shows successful invocation of the riemann_sum and fourier_transform tools, demonstrating seamless integration.

Figure 4: Detailed output from the math_calc service. The agent correctly executes both computations and provides a comprehensive analysis, validating the functionality of the final, auto-repaired tool.

3.3 Summary of Findings

Our evaluation provides strong quantitative evidence of Code2MCP’s performance. The benchmarks demonstrate a greater than 17-fold average speedup over manual methods, achieved at a modest computational cost. The case studies further reveal the underlying capabilities that drive these results: an ability to deconstruct and abstract complex real-world libraries, and a robust, self-healing mechanism that autonomously resolves common coding errors. Together, these findings validate Code2MCP as a scalable and effective solution to bridge the vast world of open-source software with the rapidly growing ecosystem of AI agents.

4 Conclusion

This paper is the first to define and explore the critical problem of automatically converting existing code repositories into Model Context Protocol (MCP) services, proposing the inaugural solution: Code2MCP. As an automated, multi-agent framework, Code2MCP aims to bridge the gap between the vast ecosystem of existing software tools and the burgeoning landscape of AI agents. Our work not only demonstrates the feasibility of this automated conversion but, more importantly, establishes a new research direction for scaling the capabilities of AI agents.

In developing Code2MCP, we have also come to recognize the significant challenges inherent in this automation task. First, scale and complexity present primary obstacles: the context length of current large language models limits our ability to process very large repositories, and the non-standard structures of real-world projects severely test the system’s adaptability. Second, the fragility of environment configuration is a critical bottleneck; complex dependencies can lead to build failures, thereby stalling our core Run-Review-Fix loop. Furthermore, the current system primarily targets the Python ecosystem, with limited support for other programming languages.

To address these challenges and advance the maturity of this field, we have charted a clear path for future work. We plan to continuously iterate on Code2MCP, integrating more advanced code comprehension techniques and language models with longer context windows to significantly improve its success rate on complex projects. More importantly, we call for the establishment of a public benchmark to systematically evaluate the performance of repository-to-MCP service conversion, providing a quantifiable standard for future research. Concurrently, we will focus on equipping the agent with an understanding of open-source social etiquette to ensure its contributions are valuable and well-received by the community.

Our long-term vision is that by continuously refining automated tools like Code2MCP, we can finally overcome the “last-mile” barrier of tool integration. We firmly believe this will dramatically accelerate the growth of the MCP ecosystem, laying a solid foundation for a truly interconnected and capable next-generation of AI agents.