Frequency Domain Berry Curvature Effect on Time Refraction

Abstract

We demonstrate that there exist frequency domain Berry curvature in the wave function of photons in dispersive optical systems. This property arises from the frequency dispersion of its dielectric function, which makes Maxwell equations a non-standard eigenvalue equation, with the eigenvalue (frequency) appearing inside the operator itself. We study this new Berry curvature effect on time refraction of magnetoplasmon-polariton as an example. It can induce deflection in the trajectory of a photon and make the ray swing.

Wave propagation in dispersive media, where the material response depends on frequency, leads to a non-standard eigenvalue problem, in which the frequency, serving as the eigenvalue, appears within the operator of the eigenvalue equation [PhysRevB.50.16835, kuzmiak_photonic_1997, PhysRevLett.104.087401, Fietz:11, PhysRevLett.129.133903, PhysRevLett.132.126601, PhysRevA.111.042201]. Since the eigenvalue enters the equation in a nonlinear manner, such equations are also referred to as nonlinear eigenvalue equations [PhysRevB.50.16835, PhysRevLett.132.126601, PhysRevA.111.042201]. We find in these systems there exists a novel geometric property — frequency domain Berry curvature, which does not appear in standard systems such as Schrödinger equation [RevModPhys.82.1959, PhysRevB.53.7010, PhysRevB.59.14915, PhysRevB.102.045423], even in Floquet systems [PhysRevB.106.224311].

Maxwell equations in media are always non-standard because strictly speaking, all media are dispersive with respect to frequency. We should treat frequency as a parameter on an equal footing with momentum. For this reason, the electromagnetic wave has frequency domain Berry curvature in addition to momentum domain, which is ignored in previous studies [PhysRevLett.93.083901, PhysRevLett.96.154802, PhysRevLett.100.013904, PhysRevA.78.033834] and should also be considered for a proper description of the propagation of the electromagnetic wave. In this work, we develop a semiclassical theory based on a wave packet localized in spacetime to describe wave propagation under slow perturbations in non-standard eigenvalue systems, which additionally includes frequency domain Berry curvature. We apply the theory in magnetoplasmon system [jackson1998classical, PhysRevLett.100.023902, jin_topological_2016, PhysRevLett.124.195001] and specifically study the dynamics of electromagnetic wave pulses under slow time modulation.

When a medium is modulated in time, the wave conserves its momentum but varies its frequency, this phenomenon is called time refraction [morgenthaler_velocity_1958, stepanov_spectral_1968, mendonca_theory_2000, j_t_mendonca_time_2002, PhysRevA.62.033805, Khurgin:20, zhou_broadband_2020, lustig_time-refraction_2023, PhysRevLett.132.263802, dong_quantum_2024, PhysRevLett.134.073803]. Time refraction can be classified into two types, with the modulation being adiabatic [stepanov_spectral_1968, Khurgin:20, zhou_broadband_2020, PhysRevLett.134.073803] and nonadiabatic [PhysRevA.62.033805, lustig_time-refraction_2023, PhysRevLett.132.263802] ones, based on how much the refractive index changes over a single cycle. In this letter, we study the adiabatic time refraction of electromagnetic waves in a magnetoplasmon system. We find that, due to the non-zero Berry curvature in this system, the trajectory of an electromagnetic pulse becomes deflected and the deflection is a geometric quantity. As a consequence of the deflection, the ray swings. Our work provides a robust and convenient means to control light propagation via its geometric property.

Theoretical framework— We briefly introduce our semiclassical wave packet theory to describe wave propagation under perturbations in spacetime governed by non-standard eigenvalue equations. We first employ a method consistent with Refs. [PhysRevLett.132.126601, li2025geodynamicsartificialgravityspacetime, liu2025fullyfirstprinciplesapproachstudying], introducing an auxiliary eigenvalue to standardize the eigenvalue equation. Subsequently, by superposing solutions of the auxiliary standard eigenvalue equation, we construct a wave packet localized in the eight-dimensional phase space (space-time and momentum-frequency), with the auxiliary eigenvalue at the wave packet center set to zero. Finally, we derive the equations of motion (EOM) of the wave packet by constructing its Lagrangian. The EOM incorporate Berry curvatures in all facets of the phase space. When the eigenvalue equation is standard, Berry curvature terms involving the frequency all vanish, and the EOM coincide with those in Ref. [PhysRevB.59.14915]. Detailed procedures can be found in the supplemental material [SM].

Model— In this section, we give the specific model used in our study. When considering only the photon degree of freedom, the Maxwell equations for dispersive materials represent an example of non-standard eigenvalue equation [PhysRevLett.104.087401, Fietz:11, kuzmiak_photonic_1997, PhysRevLett.129.133903]. We consider a magnetoplasmon-ploariton model: a metallic medium placed in an external static magnetic field $\mathbf{B_{0}}=B_{0}\hat{z}$ [jackson1998classical, PhysRevLett.100.023902, jin_topological_2016, PhysRevLett.124.195001]. We made lossless approximation in dielectric tensor Eq. (1), which holds as long as the relaxation time is much longer than the timescale of interest $(\sim 100\omega_{p}^{-1})$. Example systems include InSb [WhalenWestgate1969, Cheeke1981, PhysRevResearch.2.023180] and gas plasmas [PhysRevLett.124.195001]. Neglecting dissipation and assuming that the radiational magnetic field is much smaller than the external magnetic field, its dielectric tensor can be described by the Drude model as following [jackson1998classical, PhysRevLett.100.023902, PhysRevResearch.2.023180]:

$$\stackrel{{\scriptstyle\leftrightarrow}}{{\varepsilon}}(\omega)=1-\frac{\omega_{p}^{2}}{\omega^{2}-\omega_{B}^{2}}\begin{pmatrix}1&-i\frac{\omega_{B}}{\omega}&0\\ i\frac{\omega_{B}}{\omega}&1&0\\ 0&0&1-\frac{\omega_{B}^{2}}{\omega^{2}}\end{pmatrix},$$ (1)

where $\omega_{p}=\sqrt{\frac{Ne^{2}}{m}}$ is the plasmon frequency of the metal, $\omega_{B}=\frac{eB_{0}}{m}$ is cyclotron frequency. The external magnetic field breaks time-reversal symmetry. Next, we apply temporal modulation in this system, while spatial homogeneity is maintained. We let the plasmon frequency change over time [PhysRevE.103.043207, wang_expanding_2025] in the manner of $\omega_{p}(t)=\omega_{p}(0)+\xi t$ with $\xi\ll\omega_{p}^{2}$ [stepanov_spectral_1968]. Under such an adiabatic condition, the transmission of a single-mode light can be described by our wave packet theory.

We now explain how our general framework is applied to this specific example. Maxwell’s equations can be expressed in matrix form in frequency domain as [PhysRevLett.100.013904, PhysRevA.78.033834, PhysRevA.81.053803],

$$\hat{\mathcal{H}}(\mathbf{k})|\psi(\omega,\mathbf{k},t_{c})\rangle=\omega\hat{\Theta}_{c}(\omega,t_{c})|\psi(\omega,\mathbf{k},t_{c})\rangle,$$ (2)

where $\hat{\mathcal{H}}=\begin{pmatrix}0&-\mathbf{k}\times\\ \mathbf{k}\times&0\end{pmatrix}$, $|\psi\rangle=(\mathbf{E},\mathbf{H})^{T}/\sqrt{2}$ is the electromagnetic wave function and $\hat{\Theta}_{c}(\omega,t_{c})=\begin{pmatrix}\stackrel{{\scriptstyle\leftrightarrow}}{{\varepsilon}}(\omega,t_{c})&0\\ 0&\stackrel{{\scriptstyle\leftrightarrow}}{{\mu}}\end{pmatrix}$. We have used the local operator approximation in Eq. (2) as in Ref. [PhysRevB.59.14915]. The difference is that, in Eq. (2), the eigenvalue, frequancy, appears in the operator $\hat{\Theta}_{c}$ of the eigenvalue equation, thus forming a non-standard eigenvalue equation. We have set the speed of light in vacuum $c=1$ in Eq. (2) and the permeability tensor $\stackrel{{\scriptstyle\leftrightarrow}}{{\mu}}=1$ in our model. Eq. (2) is not a standard eigenvalue equation. We can standardize it by going “off-shell” and introducing an auxiliary eigenvalue $\lambda$:

$$\hat{\mathcal{L}}_{c}(\omega,\mathbf{k},t_{c})|\psi(\omega,\mathbf{k},t_{c})\rangle=\lambda_{c}\hat{\theta}_{c}(\omega,t_{c})|\psi(\omega,\mathbf{k},t_{c})\rangle,$$ (3)

where $\hat{\mathcal{L}}_{c}=\hat{\mathcal{H}}-\omega\hat{\Theta}_{c}$ and $\hat{\theta}_{c}$ should be an artificially chosen (semi-)positive-definite operator. Here $\hat{\theta}_{c}(\omega,t_{c})=\text{diag}\{\theta,\theta,\theta,1,1,1\}$ is chosen as the energy density operator [landau1995electrodynamics, jackson1998classical, PhysRevLett.100.013904] without the external magnetic field, where $\theta=1+\frac{\omega_{p}^{2}}{\omega^{2}}$. We call Eq. (3) “off-shell equation” because only when $\lambda=0$ do the solutions of Eq. (3) correspond to the real physical world. This standard eigenvalue equation for $\lambda$ will yield a set of orthonormal basis functions that satisfy the following conditions:

$$\langle\psi_{m}(\omega,\mathbf{k},t_{c})|\hat{\theta}_{c}(\omega,t_{c})|\psi_{n}(\omega,\mathbf{k},t_{c})\rangle=\delta_{mn},$$ (4)

The inner product here includes integration over the spacetime coordinates $(\mathbf{r},t)$ and the subscripts “m” and “n” represent different bands. To describe the geometrodynamics of a particle, we construct a wave packet localized in spacetime, expressed as:

$$\left|W\left(\omega_{c},\boldsymbol{k}_{c},t_{c},\boldsymbol{r}_{c}\right)\right\rangle$$ (5)

$$= \int d\omega d\boldsymbol{k}a\left(\omega,\mathbf{k}\right)\hat{\theta}^{\frac{1}{2}}_{c}\left(\omega,\boldsymbol{k},t_{c},\boldsymbol{r}_{c}\right)\left|\psi\left(\omega,\boldsymbol{k},t_{c},\boldsymbol{r}_{c}\right)\right\rangle.$$

$a\left(\omega,\mathbf{k}\right)$ is a function localized around $\omega_{c}$ and $\mathbf{k}_{c}$ and the eigenvalue at the center of the wave packet satisfies $\lambda_{c}(\omega_{c},k_{c},t_{c})=0$. In the following, we omit the subscript “c” of the operator and eigenvalue. The selection of different $\hat{\theta}$ operators represents wave packets centered on different physical quantities. We chose $\hat{\theta}$ as “energy density operator at $B_{0}=0$” for mathematical convenience. For another physical quantity $\hat{\theta}^{\prime}$, its center position $\mathbf{r}^{{\theta}^{\prime}}_{c}$ has a dipolar correction from the previous one [RevModPhys.82.1959, PhysRevLett.93.046602, PhysRevLett.124.066601]:

$$\mathbf{r}^{{\theta}^{\prime}}_{c}=\frac{\langle\frac{1}{2}(\hat{r}\hat{\theta}^{\prime}+\hat{\theta}^{\prime}\hat{r})\rangle}{\langle\hat{\theta}^{\prime}\rangle}=\mathbf{r}^{\theta}_{c}+\frac{\left\langle\frac{1}{2}\left((\hat{r}-\mathbf{r}^{\theta}_{c})\hat{\theta}^{\prime}+\hat{\theta}^{\prime}(\hat{r}-\mathbf{r}^{\theta}_{c})\right)\right\rangle}{\langle\hat{\theta}^{\prime}\rangle},$$ (6)

where $\langle\hat{\mathcal{O}}\rangle=\langle W|\hat{\theta}^{-\frac{1}{2}}\hat{\mathcal{O}}\hat{\theta}^{-\frac{1}{2}}|W\rangle$ for wave packet average, and $\mathbf{r}^{{\theta}}_{c}$ is the center of the previously chosen operator $\mathbf{r}^{{\theta}}_{c}=\langle\hat{\mathbf{r}}\rangle$.

Now we analyze the solutions of the eigenvalue equation. We focus on electromagnetic waves propagating in the plane perpendicular to the external magnetic field (x-y plane), now the eigen-modes of the electromagnetic waves can be decoupled into TE and TM ones due to the mirror symmetry perpendicular to the z-axis $\mathcal{M}_{z}$ [joannopoulos2008photonic]. We consider the TE mode with $\psi_{TE}=\left(E_{x},E_{y},0,0,0,H_{z}\right)^{T}/\sqrt{2}$ (the electric field has components only in the x-y plane, whereas the magnetic field has components only along the z-direction). Because of the breaking of time-reversal symmetry, the degeneracy of the TE and TM modes is lifted. For the TE modes, its dispersion relation is

$$k=\sqrt{\frac{\omega^{4}+\omega_{p}^{4}-\omega^{2}\left(\omega_{B}^{2}+2\omega_{p}^{2}\right)}{\omega^{2}-\omega_{B}^{2}-\omega_{p}^{2}}},$$ (7)

where $k=\sqrt{k_{x}^{2}+k_{y}^{2}}$. From the off-shell eigen-equation (3), we can solve for the dispersion $\lambda_{TE}$ and the eigen-state $\psi_{TE}$ corresponding to the TE modes [SM]. We then refer to Eq. (7) as TE on-shell condition.

Then we apply the EOM of the wave packet from the general framework to this system and they simplify to :

$$\dot{\mathbf{r}} =\mathbf{v}_{g}-(\Omega_{\mathbf{k}t}+\mathbf{v}_{g}\Omega_{\omega t}+\Omega_{\mathbf{k}\omega}\dot{\omega});$$ (8a)

$$\dot{\omega} =P-\dot{\omega}\Omega_{\omega t};$$ (8b)

$$\dot{\mathbf{k}} =0.$$ (8c)

Hereafter, the subscript c denoting the center of the wave packet is omitted. $\mathbf{v}_{g}\equiv\frac{\partial\omega}{\partial\mathbf{k}}=\partial_{\mathbf{k}}\lambda/(-\partial_{\omega}\lambda)$ is group velocity, $P\equiv\frac{\partial\omega}{\partial t}=\partial_{t}\lambda/(-\partial_{\omega}\lambda)$ is named chirp rate [PhysRevA.110.033519]. $\Omega_{pq}$ are Berry curvatures calculated at the center of wave packet defined as $\Omega_{pq}\equiv-2\operatorname{Im}\langle\partial_{p}v|\partial_{q}v\rangle$, where $|v\rangle=\hat{\theta}^{\frac{1}{2}}|u\rangle$ with $|u\rangle$ the amplitude part of the wave function $|\psi\rangle$ that satisfies normalization condition $\langle u|\hat{\theta}|u\rangle=1$, and $p,q=\{t,k_{x},k_{y},\omega\}$. The eigenvalue $\lambda$ and the wave function used in calculating Eq. (8) are functions of $\omega$, $\mathbf{k}$ and $t$. Ultimately, these functions must be restricted by the TE on-shell condition Eq. (7). Eq. (8c) represents momentum conservation in this spatially homogeneous system, while Eq. (8a) and Eq. (8b) represent adiabatic time refraction on the trajectory and frequency of an electromagnetic pulse, including corrections from the Berry curvature. Using Eq. (8), one can determine the trajectory and frequency at any moment of an electromagnetic pulse propagating in this system. Notably, the “energy” $\lambda$ of the wave packet is conserved in Eq. (8). If the wave packet is initially on-shell (satisfy Eq. (7)), it remains on-shell throughout its evolution in phase space.

In the following, we illustrate the physics of time refraction described by Eq. (8a). In this isotropic system, the group velocity of a wave packet $\mathbf{v}_{g}$ is parallel to the momentum $\mathbf{k}$. The temporal modulation $\xi$ is suddenly applied at $t=0$ and the velocity acquires an anomalous component $\mathbf{v}_{a}=-(\Omega_{\mathbf{k}t}+\mathbf{v}_{g}\Omega_{\omega t}+\Omega_{\mathbf{k}\omega}\dot{\omega})$ that is perpendicular to $\mathbf{v}_{g}$. If we regard the frequency as an auxiliary variable, one sees that when differentiating with respect to any other parameter, one must also include its indirect dependence on the frequency. By defining an on-shell Berry curvature $\Omega_{\mathbf{k}t}^{on}=\Omega_{\mathbf{k}t}+\frac{\partial\omega}{\partial\mathbf{k}}\Omega_{\omega t}+\Omega_{\mathbf{k}\omega}\frac{\partial\omega}{\partial t}$, the anomalous velocity above reduces to the familiar Thouless-pumping term [PhysRevB.27.6083]. The group velocity remains parallel to the momentum direction through the process while the magnitudes of the group velocity and the anomalous velocity change during the time evolution. We show this process in Fig. 1.

Figure 1: (a) The temporal modulation $\xi$ is applied at $t=0$ and the pulse’s velocity acquires an anomalous component that is perpendicular to the group velocity. (b) $\xi$ is removed at $t=t_{f}$ and the pulse loses the anomalous velocity immediately.

Time-dependent Berry curvature fields— In this part, we analyze the Berry curvature field involved in this context. Fig. 2 shows $\mathbf{v}_{g}$ and $\Omega_{\omega\mathbf{k}}$ involved in Eq. (8) for the upper TE band. Other terms are not shown in the picture because $P$ is a scalar field that has a relatively simple structure, while $\Omega_{\mathbf{k}t}$ has the same distribution and direction as $\Omega_{\omega\mathbf{k}}$ and $\Omega_{\omega t}=0$ in this case [footnote]. The distribution of these fields maintains the rotational symmetry of the system. Moreover, $\Omega_{\mathbf{k}\omega}$ and $\Omega_{\mathbf{k}t}$ are everywhere perpendicular to $\mathbf{v}_{g}$ as described by Fig. 1. Therefore, $\Omega_{\mathbf{k}\omega}$ and $\Omega_{\mathbf{k}t}$ lead to a new type of Hall effect of light (unlike the spatially inhomogeneous case discussed in Ref. [PhysRevLett.93.083901]). All terms in Eq. (8) need to be calculated under the on-shell condition Eq. (7), in which $\omega$ depends only on the magnitude of $\mathbf{k}$. In Fig. 2, this condition is expressed as the red dashed circle.

Figure 2: (a) Group velocity $\mathbf{v}_{g}$. (b) Berry curvature $\Omega_{\mathbf{k}\omega}=(\Omega_{k_{y}\omega},\Omega_{k_{x}\omega})$ in $k_{x}-k_{y}$ plane at $t=0$ with parameters $\omega_{B}=\omega_{p}(0)$, $\xi=0.01\omega_{p}^{2}(0)$ and $\omega=1.75\omega_{p}(0)$. The red dashed circles represent the on-shell condition $k(\omega=1.75\omega_{p}(0))=1.059\omega_{p}(0)/c$.

Then we investigate Berry curvatures under the on-shell condition Eq. (7), which are single-valued functions of $\omega$, as we present in Fig. 3 along with the dispersion relation defined by Eq. (7). Figs. 3(a) and 3(b) show the dispersion curves in the absence of $\mathbf{B_{0}}$ and for $\omega_{B}=1$, respectively. In our dispersion plots, the horizontal and vertical axes are opposite to those commonly used in the previous literature to make it easier to compare with the Berry curvature plotted as a function of frequency. When $\mathbf{B_{0}}=0$, one branch of the TE mode has a constant frequency $\omega_{p}$ (longitudinal), and the other branch is degenerate with the TM mode (transverse) [PhysRevLett.134.183801]. Once $\mathbf{B_{0}}$ is turned on, the TM dispersion remains unaffected, but the two branches of the TE mode hybridize with each other and open a gap, lifting the degeneracy between the TE and TM modes. The hybridization leads to nonzero Berry curvatures which are zero at $k=0$, corresponding to the frequency $\omega_{0}=1.618\omega_{p}$ (the golden ratio) and reach a peak and then gradually decrease back to zero as the frequency increases. The group velocity gradually increases and approaches the speed of light in vacuum, while the chirp rate decreases with frequency. The two parts of the anomalous velocity, $\Omega_{\mathbf{k}\omega}P$ and $\Omega_{\mathbf{k}t}$, are of the same order of magnitude, both around $10^{-3}c$ at maximum in this setting.

Figure 3: Dispersion curves (a) without external magnetic field and (b) with finite external magnetic field $\omega_{B}=\omega_{p}$. (c) The group velocity $\mathbf{v}_{g}$ and chirp rate $P$. (d) Magnitudes of Berry curvatures $\Omega_{\mathbf{k}\omega}$ and $\Omega_{\mathbf{k}t}$ of the upper branch TE mode calculated under the on-shell condition (7) as a single-valued function of $\omega$ at $t=0$ with $\xi=0.01\omega^{2}_{p}(0)$.

Trajectories and ray swings— Finally, we study the dynamics in real space of an electromagnetic wave packet or a light bullet [PhysRevLett.134.073803]. Given an initial pulse frequency $\omega(0)$, we compute the corresponding on-shell momentum from Eq. (7), and then use Eq. (8) to calculate the evolution of its position and frequency. The solid line of Fig. 4(a) depicts the trajectory of a pulse with an initial frequency $\omega(0)=2\omega_{p}(0)$, where the color of a point on the trajectory represents the central frequency of the pulse at the moment it reaches that point. The momentum is set to be along the x-axis. Due to the sudden transition of the terms $\Omega_{\mathbf{k}t}$ and $\dot{\omega}$ in Eq. (8a) from zero to finite values at the moment $t=0$, the direction of the pulse velocity undergoes an instantaneous finite change, as illustrated in Fig. 1(a). During this whole process, the displacement of the pulse perpendicular to its momentum direction is given by the integral of the anomalous velocity over time:

$$\delta\mathbf{r}_{y}=\int_{0}^{t_{f}}\mathbf{v}_{a}(t)dt$$ (9)

$$= \int_{\omega_{p(0)}}^{\omega_{p}(t_{f})}\frac{(\partial_{\mathbf{k}}\lambda)\Omega_{\omega\omega_{p}}+(\partial_{\omega_{p}}\lambda)\Omega_{\mathbf{k}\omega}-(\partial_{\omega}\lambda)\Omega_{\mathbf{k}\omega_{p}}}{\partial_{\omega}\lambda}d\omega_{p}.$$

where we have used the relations $\partial_{t}=\dot{\omega}_{p}\partial_{\omega_{p}}$ and $d\omega_{p}=\dot{\omega}_{p}dt$. We also replaced $\dot{\omega}$ with $P$ in the first-order approximation. From Eq. (9), one can see that for a pulse with certain momentum, the displacement of its trajectory perpendicular to the momentum direction depends only on the initial and final values of the parameter $\omega_{p}$, and not on how fast it changes, as long as the adiabatic approximation $\dot{\omega}_{p}\ll\omega_{p}^{2}$ holds.

Figure 4: (a) The trajectories of $\hat{\theta}$ center (solid line) and $\hat{\theta}^{\prime}$ center (dashed line) for a pulse with initial frequency $\omega(0)=2\omega_{p}(0)$ emitted at $t=0$. (b) Ray swings (solid lines) for continuously emitted pulses with the same initial frequency of $\omega(0)=3.6\omega_{p}(0)$ The dashed line represents the trajectory of the first emitted pulse. In both (a) and (b), the color maps the frequency of the pulse at the moment it reaches that point, and the black rays denote the pulse’s trajectory in the absence of the time modulation. The variations of (c) the initial deflection angle and (d) the total displacement with the initial frequency, where $\gamma$ and $\delta r_{y}$ corresponds to the center of $\hat{\theta}$, and $\gamma^{\prime}$ and $\delta r_{y}^{\prime}$ represent the center of $\hat{\theta}^{\prime}$.

Based on the trajectory of the center of $\hat{\theta}$, we can use Eq. (6) to calculate the trajectory of the center of any other physical quantity. For example, for the total energy center $\hat{\theta}^{\prime}=\partial_{\omega}(\omega\hat{\Theta})$ [landau1995electrodynamics, jackson1998classical, PhysRevLett.100.013904], Eq. (6) can be simplified as [SM]

$$\mathbf{r}^{{\theta}^{\prime}}_{c}-\mathbf{r}^{\theta}_{c}=\frac{\operatorname{Im}\langle\partial_{\omega}u|\hat{\mathcal{L}}|\partial_{\mathbf{k}}u\rangle}{\partial_{\omega}\lambda}.$$ (10)

The dashed line in Fig. 4(a) shows the trajectory of $\hat{\theta}^{\prime}$ center, Fig. 4(c) and (d) present the variations of the initial deflection angle and total displacement of centers of energies with and without magnetic field with the initial frequency, respectively. The initial deflection angle becomes large when $\omega$ is close to $\omega_{0}$, because the x-component of velocity, i.e., the group velocity, is relatively small there. The trend of total displacement is similar to the Berry curvatures in Fig. 3(d), since they both are directly related to the anomalous velocity. The total displacement is $\sim 10^{-1}c/\omega_{p}$ at the frequency near the band bottom $\omega_{0}$, which is about $10\mu m$ for InSb [PhysRevResearch.2.023180, buddhiraju_absence_2020] and $1mm$ for gaseous plasma [PhysRevLett.124.195001].

Next, we consider the case of continuously emitted pulses, as shown in Fig. 4(b). In this case, pulses emitted at different moments will experience different environments, resulting in distinct motion trajectories. We assume that these pulses are incoherent. Suppose that we begin emitting pulses at $t=0$ and observe later, the shape of light will be given by the connecting lines of the current positions of all previously emitted pulses. The region where energy is transmitted is the finite area formed by the motion trajectories of all the pulses. Starting from $t=0$, pulses with a frequency of $\omega(0)=3.6\omega_{p}(0)$ and $\mathbf{k}=k\hat{x}$ are continuously emitted from the origin. We plot the trajectory of the pulse emitted at $t=0$ as the dashed line. Then, for a fixed observation time $t>0$, we connect the points corresponding to that moment on all the trajectories of the previously emitted pulses, with the connecting lines represented by solid lines, which represent the shape of light at that moment. The appearance of this line changes over time, which is the ray swinging phenomenon we mentioned previously. The region enclosed by the solid and dashed lines represents the area in which energy is transmitted at the corresponding moment $t$. This process is shown in the supplemental animation.

We point out that the Berry curvature fields in this context satisfy two source-free Maxwell equations. The Berry curvature tensor satisfies the Bianchi identity $\partial_{\lambda}\Omega_{\mu\nu}+\partial_{\mu}\Omega_{\nu\lambda}+\partial_{\nu}\Omega_{\lambda\mu}=0,\quad\mu,\nu,\lambda=0,1,2,3$. In our model, the parameter space $\{t,k_{x},k_{y},\omega\}$ is four-dimensional, similar to the 3+1 dimensional real space $x^{\mu}=\{t,x,y,z\}$ and reciprocal space $k^{\mu}=\{\omega$,$k_{x}$,$k_{y}$,$k_{z}\}$. Thus, we can define gauge fields in a manner analogous to the electromagnetic field strength tensor $F_{\mu\nu}$, which satisfies Faraday’s law $\nabla\times\mathbf{e}+\partial_{t}\mathbf{b}=0$ and Gauss’s law for magnetism $\nabla\cdot\mathbf{b}=0$, where $\mathbf{e}=\{\Omega_{tk_{x}},\Omega_{tk_{y}},\Omega_{t\omega}\}$ and $\mathbf{b}=\{-\Omega_{\omega k_{y}},\Omega_{\omega k_{x}},\Omega_{k_{x}k_{y}}\}$. The Berry curvature in real space corresponds to the direct electromagnetic field [PhysRevB.59.14915], while the Berry curvature in reciprocal space corresponds to the reciprocal electromagnetic field [PhysRevB.53.7010, PhysRevLett.97.216601, PhysRevB.110.075139]. In our case, the relevant parameter space involves a mix of time coordinates and reciprocal space coordinates, as in [PhysRevB.98.064310, PhysRevResearch.7.023085]. In this non-standard system, the frequency domain Berry curvature allows us to construct a four-dimensional set of Maxwell equations with two spatial dimensions.

Discussion— Our theoretical framework can also include spatially inhomogeneity or even combined space-time inhomogeneous situations. In such cases, the momentum of the wave packet is no longer conserved, and the Berry curvature in the spatial domain also enters the equations of motion. Due to the non-standard nature of the eigenvalue equation, each term must also include a correction involving the derivative with respect to frequency, as described by the full set of EOM under spacetime perturbations [SM]. Unlike pure time refraction, in the presence of spatial inhomogeneity, since the momentum is not conserved, the direction of the velocity after modulation is no longer parallel to the initial velocity.

Although this work focuses mainly on the localized Berry curvature effect in parameter space, the global topological properties of non-standard eigenvalue problems can also be described within our framework using the auxiliary eigenvalue. Under the on-shell condition, only two of $\{\omega,k_{x},k_{y}\}$ are independent, so the topology of our system can be fully described by the on-shell Berry curvature defined as

$$\Omega^{on}_{\mathbf{k}\mathbf{k}}\equiv\Omega_{\mathbf{k}\mathbf{k}}+\mathbf{v}_{g}\cdot\Omega_{\mathbf{k}\mathbf{k}}+\Omega_{\mathbf{k}\mathbf{k}}\cdot\mathbf{v}_{g}.$$ (11)

This expression takes into account the indirect dependence on $\omega$ when differentiating with respect to $\mathbf{k}$. Using the on-shell Berry curvature, the EOM has the same form as that for Bloch electrons. It is an expression of $\omega$, $k_{x}$ and $k_{y}$. The corresponding Chern number $C^{on}=\int dk_{x}dk_{y}\Omega^{on}_{k_{x}k_{y}}|_{\lambda=0}$ should take $\omega$ as its on-shell value determined by Eq. (7) when performing the integration. For the two TE bands with lower and higher frequencies, the on-shell Chern numbers are $+1$ and $-1$, respectively.

The theory in this work is focused on adiabatic situations and cannot be applied to rapidly changing ones. Although how to extend the theory to non-adiabatic cases is also an important issue, there is rich physics even in adiabatic cases, as discussed in this work, which provides guidance to relevant experiments. Experimentally, time-varying frequency-dispersive materials have recently been investigated under a rapidly changing mechanism [wang_expanding_2025, PhysRevLett.134.183801, PhysRevB.108.104303]. Future experimental studies could explore adiabatic temporal modulation in systems with broken time-reversal or spatial-inversion symmetry, wherein the underlying physics can be described by Berry curvatures.

Acknowledgement— This work was supported by the National Key R$\&$D Program of China (2023YFA1407001) and National Natural Science Foundation of China (12234017).