Metabolic State Shift and Stochastic Cell Culture Process Prediction

Keywords Cell culture process prediction, bioprocess stochastic and hybrid model, metabolic state shift, metabolic flux analysis, KG-based experience replay

Journals to consider: (1) Computers & Chemical Engineering; (2) PLOS; and (3) Metabolic Engineering

1 Introduction

Living cells (i.e., mammalian cells, CHO cells, stem cells, cancer cells, and yeasts) demonstrate widespread flexibility and robustness in the face of adverse extracellular insults. Under environmental perturbations and stresses (such as oxygen and nutrient starvation), the cells often adapt to unfavourable conditions through metabolic state shift and changes in the molecular networks, such as CHO and stem cells can shift uptaking glucose as carbon source to lactate under the environment with low glucose and high lactate, which is often faced in large-scale manufacturing. The metabolic shift and gene expression stability directly impact on the cell culture process output trajectory.

Our goal is to develop a probabilistic knowledge graph hybrid model and risk-based process analytical technology (PAT) framework that can: (1) model and provide a reliable prediction on cell culture process dynamics and metabolic state shift; (2) integrate online and offline data to advance the knowledge on underlying mechanism of cell central metabolism and its response to environmental perturbation; (3) guide intelligent and selective experience replay; and (4) facilitate optimal cell culture process control to support large-scale and flexible manufacturing for bio-drugs and bio-fuels (such as mAbs). In this paper, we focus on CHO cell and mAb protein production even though the proposed modeling and PAT methodology can be applicable to various cells and yeasts.

(1) Probabilistic knowledge graph (KG) hybrid model for cell culture stochastic decision process (SDP). This probabilistic graphical model is a metabolic mechanism-based stochastic model representing a risk- and science-based understanding of cell response to environmental perturbation under different life-cycles. Since this KG hybrid model is built on molecular reaction networks, it can integrate heterogeneous online/offline intra- and extra-cellular measurements and advance the understanding of cell culture mechanisms to explain and predict metabolic and gene regulatory network pattern change. It will model the dynamics change of state (i.e., extra- and intra-cellular enzymes, proteins, metabolites, media) under the environmental perturbation (i.e., cell culture conditions) induced by action (i.e., agitation, oxygen/nutrient feeding rates). This KG hybrid model will leverage existing genome scale model and facilitate mechanism learning from data. Thus, our study can advance the scientific knowledge on how factors at cell and system levels (e.g., metabolic regulatory networks of cells and environment conditions) interactively impact on cell adaptive behaviors and cellular functionalities, as well as cell culture process trajectory dynamics and variations.

(2) Create a bioprocess hybrid model accounting for metabolic state shift. We will develop a metabolic state shift stochastic model as a function of environmental conditions, cell age, stress, and gene expression. It will account for the delay between gene expression change and metabolic state shift. The underlying metabolic state, denoted by $Z_{t}$, can be used to classify cells. We will create a stochastic decision process hybrid model and stochastic metabolic flux characterizing the functional behaviors of cells in each class (such as growth and production phase).

(3) Develop a Bayesian KG accounting for both process inherent stochasticity and model uncertainty. Bayesian data analytics will be provided to facilitate cell culture process mechanism learning and faithfully quantify all sources of uncertainty, including bioprocess inherent stochasticity, model uncertainty, and measurement error. By fitting the KG hybrid model to heterogeneous online and offline measurements, we will create an efficient computational approach to infer latent metabolic state. Based on the historical observations (such as protein/metabolite concentrations). It can real-time estimate the change in flux rates, detect and predict metabolic state shift. This study will enable the inference on multiple metabolic states of cells and improve the understanding of intrinsic apoptosis pathways and metabolic state shift activated in response to hypoxia and nutrient starvation. The metabolic state can be used to classify cells.

(4) Develop likelihood ratio based experience replay to improve culture process prediction. Each metabolic state has the SDP process model parameters characterizing the process dynamics and variations. Built on the bioprocess hybrid model (characterizing the similarity and difference of cell functional behaviors under different metabolic states), we will have likelihood-ratio-based experience replay to intelligently select out the most relevant historical state-transition observations and leverage the information from them to improve the prediction. The LR-based predictor will put more weights on the historical observations based on their ”closeness” to the current culture process state and cell metabolic behaviors.

We will fully utilize all historical data observed under different metabolic states to improve process prediction. We will create Bayesian KG, accounting for bioprocessing inherent stochastic and model uncertainty, which can detect metabolic state shift and assess cell functional behaviors. Assisted by the Bayesian KG enabling the inference on metabolic state and classification of cells, as well as intrinsic apoptosis pathways activated in response to hypoxia and nutrient starvation, we will create likelihood ratio-based experience replay and the proposed predictor can intelligently leverage related information from historical observations. The Bayesian KG based predictive analysis will be used to provide an insightful prediction on how the variations and effects of inputs (such as environment conditions) propagate through mechanism pathways and impact on the output trajectories. This study can advance the understanding of the cascading and delayed effects on gene expression, cellular metabolisms, cell growth, fate, and production. It can further guide the optimal learning strategies, that are interpretable and robust against model uncertainty, to facilitate the most sample efficient mechanism learning and guide process control that can reduce the cell stresses and maximize the outcomes.

Therefore, this study can provide: (a) enhanced prediction of cell metabolic state trajectory dynamics; (b) real-time assessment of metabolic shifts; and (c) guide timely adjustments of process control of feeding strategies and culture conditions to improve productivity and reduce impurities.

Literature review on cell central metabolism modeling and metabolic state shift for mammalian cells (i.e., CHO, stem, cancer cells, and yeasts), and cell culture process prediction

Here we summarize the key contributions below.

• We create a multi-scale mechanistic model for integrated cell culture process accounting for metabolic state shift to advance the scientific understanding and improve the prediction.

  The multi-scale hybrid model characterizes the dynamics of mixture of cells, accounting for metabolic state shift and cells in different phases (i.e., growth, production, and death phases). The metabolic state shift hybrid model considers how age and culture conditions (including the time interval staying under certain environment and even when) impact on metabolic regulatory networks

• KG assisted experience reuse. The metabolic state of each state-action transition occurring along the cell culture process trajectory will be used to classify all historical observations so that we can: (1) better estimate the dynamics and mechanisms of cells under each state; (2) support the strategic reuse accounting the similarity and difference of metabolic network patterns under different states; and (3) improve the prediction.

• Improve the prediction and quantify the prediction uncertainty for integrated cell culture process. The proposed multi-scale hybrid model characterizes the causal interdpendencies and it integrates the online/offline data to improve the cell culture process prediction accuracy.

• (optional) Model-based control and compare the performance with state-of-art PID control strategy. We will develop a hybrid model assisted reinforcement learning for process control. There are some potential limitations of current PID feedback control. (1) Since it is built on PDE/ODE mechanistic model, it only considers short-time immediate impact. Thus, PID may not be able to utilize some information (such as gene expression) to predict in long term and strategically adjust the trajectory dynamics and variations. The fixed-point control strategy can help PID to overcome this limitation. (2) PID did not model and account for all sources of uncertainties. This impacts on mechanism learning, historical information reuse, and long-term prediction. Thus, when comparing the performance, we need to consider: a) expected productivity; and b) variations of outputs in terms of productivity and quality.

2 Data Description

2.1 Online and Offline Experiment Data Description

In this study, a recombinant CHO-K1 cell line named clone A11, expressing the anti-HIV antibody VRC01 (IgG1), was used. The experiments were conducted with a 12-way ambr250 HT bioreactor system (Sartorius Stedim, Göttingen, Germany). The bioreactors were inoculated with a target seeding density of 0.4 × 10⁶ cells/mL and a working volume of 210 mL in ActiPro media (Cytiva), supplemented with 6 mM of glutamine. Feeding followed a pyramid feeding scheme (3%/0.3% v/v Days 3–4, 4%/0.4% v/v Days 5–6, 5%/0.5% v/v Days 7–8, 4%/0.4% v/v Days 9–10, 3%/0.3% v/v Day 11 and beyond) with Cell Boost 7a/b (Cytiva), respectively. To ensure optimal conditions, dissolved oxygen levels were maintained at 50% of air saturation, employing a proportional-integral-derivative (PID) control system. For the detailed information about the experimental settings, please refer to the description in the studies [harcum2022pid, chitwood2023microevolutionary].

Off-line measurements: Samples were collected on a daily basis prior to feed additions. These samples were used to assess glucose levels and determine if additional glucose was needed. Following the addition of feeds, post-feed samples were taken to measure glucose concentrations and confirm the accuracy of glucose supplementation calculations. Daily samples before feed additions were also collected to measure various parameters, including Viable Cell Density (VCD), cell viability (Vi-Cell, Beckman Coulter), and metabolite concentrations, includes extracellular glucose, lactate, glutamine, glutamate, ammonia, and IgG concentrations, (Cedex Bio Analyzer, Roche). Furthermore, daily samples were collected for amino acid analysis (REBEL, 908 Devices) $\sim$ 10% measurement error could be considered., both before and after the feed additions.

Comprehensive analysis are performed, including Amino acid analysis, Glycosylation analysis and RNA-Seq analysis.

• Off-line measurements (daily): VCD, Cell viability, Glucose, Lactate, Glutamine, Glutamate, IgG, and Ammonia for Control (0 mM), 10 mM and 30 mM ammonia-stressed cultures.

• Amino acid (Days 0.5, 2.5, 5.5, and 8.5): Alanine and other Amino acids.

• Glycosylation (Days 2.5, 5.5, and 8.5 ): Glycan profiles for the Control (0 mM), and 10 mM ammonia-stressed standard-aged CHO cell culture.

• RNA sequencing (RNA-Seq) (Days 2.5, 5.5, and 8.5 ): gene expression level are measurement for both Control (0 mM) and 10 mM ammonia-stressed cultures for standard-aged cell (only available at tigr6).

On-line measurements: The ambr 250 system continuously recorded critical process parameters (CPPs) in real-time, including the bioreactor’s working volume, feeding/sampling volume, feeding strategy, and parameters related to oxygen consumption (e.g., dissolved oxygen levels, air/oxygen flow rates in and out, etc.). In specific, the on-line measurements from Ambr system: Time, Air flow rate, Base flow rate, Base volume pumped, CO₂ flow, CO₂ volume pumped, DO, Feed volume added, Glucose pump flow rate, Glucose volume pumped, Inlet O₂, O₂ flow rate, Volume O₂ pumped, Offgas CO₂, Offgas O₂, pH, Stir speed, Temperature.

Figure 1: Cell characteristic for control cultures in Tigr 15 and Tigr 20.

Key observations from two representative data sets; see the orange lines for Tigr 15 and the green lines for Tigr 20 illustrated in Figure 1:

• The cell growth rates are relatively stable across both datasets.

• The glucose feeding strategy remains relatively consistent between the two datasets.

• In comparison to Tigr 20, Tigr 15 exhibits a significantly lower lactate production rate. Increased flow of branched-chain amino acids (BCAAs) into the TCA cycle can boost energy production and, in some cases, reduce lactate production. This occurs because the TCA cycle generates energy by oxidizing various substrates, including BCAAs, leading to ATP production without lactate accumulation. However, the glucose consumption rate remains relatively consistent across both datasets.

• The titer (i.e., IgG concentration) is notably higher for Tigr 15.

• There are significant differences in the feeding strategy for branched-chain amino acids (BCAA), particularly isoleucine and valine. These distinctions could be attributed to variations in the concentrations of these amino acids in the feeding solutions. Such differences in feeding methods may explain why Tigr 15 achieved higher final titers in comparison to Tigr 20.

Thus, the additional regulatory mechanisms incorporated:

• Inclusion of BCAA consumption in the synthesis equations for biomass and IgG.

• Consideration of the effects of BCAA on the lactate production rate.

2.2 Exploratory Data Analysis

In CHO cells, depletion of glutamine serves as a perturbation event triggering a metabolic transition. This nutrient is rapidly consumed in cell culture systems, leading to metabolic changes in the cells.

In response to glutamine depletion, a fraction of the cell population undergoes metabolic adjustments by modulating specific enzymes. Glutamine synthetase, responsible for synthesizing glutamine, undergoes reversal. Instead of converting glutamate and ammonia to glutamine, it converts glutamine back into glutamate and ammonia.

Another enzyme involved in the metabolic response is lactate dehydrogenase. Normally, it catalyzes the conversion of pyruvate to lactate through lactate fermentation. However, in the presence of glutamine depletion, lactate dehydrogenase reverses its activity, converting lactate back into pyruvate.

These adaptive enzyme reversals contribute to a heterogeneous cell population, where some cells swiftly adapt to the perturbation, while others continue to maintain a balanced growth rate.

Time lagged cross correlation (TLCC) can identify directionality between two signals such as a leader-follower relationship in which the leader initiates a response that is repeated by the follower. Note that these still do not necessarily reflect true causality. Nonetheless, we can still extract a sense of which signal occurs first by looking at cross-correlations.

• Glucose: The correlation pattern is not clear.

• Lactate: There is a strong positive correlation between the growth rate at time $t$ and the changing rate of lactate at time $t-1$ or $t-2$. Specifically, the changing rate of lactate tends to lead the growth rate by 1 to 2 days.

• Glutamine: There is a strong negative correlation between the growth rate at time $t$ and the changing rate of glutamine at time $t-1$ or $t-2$. Specifically, the changing rate of glutamine tends to lead the growth rate by 1 to 2 days.

• Glutamate & Ammonia: Also have a strong positive correlation with growth rate with lag 1 to 2 days.

H1: We can assume the ammonia force the CHOs to go to the stationary phase early, causing the relatively low global growth rate. Also can observe it via tigr 4 BR5 and tigr 4 BR6.

H2: One possible explanation for the delay in the metabolic transition is the presence of intracellular glutamine or other internal reserves and alternative sources (e.g., Asp).

These reserves can sustain cell growth behavior for a relatively longer period, even in the absence of extracellular glutamine. Taking into account the strong relationship between glutamine and glutamate, we can focus our metabolic model on the effects of glutamine, lactate, and ammonia on the shift in metabolic state. Time is also a critical factor in understanding the metabolic state shift. To mitigate overfitting and streamline the model, we will exclusively consider the lag 1 influence of the consumption/production rate of each state variable.

To simplify the model, we will focus on four phases: the early/late exponential growth phase, the stationary phase, and the decline phase. The late exponential growth phase can be defined as the transitional period between the early exponential growth phase and the stationary phase. During the early exponential growth phase, the cell population undergoes rapid and exponential growth, characterized by a high computation/production rate of various metabolic variables. As the cell population enters the late exponential growth phase, the growth rate starts to slow down, and metabolic dynamics undergo a transition. The computation/production rate of the state variables begins to change, reflecting the metabolic adjustments in response to limited resources or other factors influencing the transition to the stationary phase. The stationary phase is characterized by a relatively constant cell population size, with the computation/production rate of state variables reaching a steady state.

3 Multi-Scale Cell Culture Process Model with Metabolic State Shift

We introduce a multi-scale mechanistic model characterizing spatio-temporal causal interdependencies at molecular, cellular, and system levels to support mechanism learning and process control; see an illustration in Fig. 2. This model enables the integration of heterogeneous data and leverages the information from existing macro-kinetics and genome scale models. It can advance the understanding on: (1) how the metabolic and proteomic network of living cells is ‘wired’; (2) how culture conditions and cell age impact on the changes of metabolic regulatory network; and (3) how input factors at cell and process levels (e.g., the genome and metabolic networks of the cells, media formulation, feeding strategies, and bioprocessing conditions) interactively impact on bioprocess output trajectories, e.g., prolonging the production phase, improving productivity and reducing impurities. Thus, this mechanistic model, accounting for inherent stochasticity, can support the integrated design and control at cellular and macro-scope levels.

Figure 2: Multi-scale bioprocess KG characterizing causal interdependencies at molecular/cellular/system levels and leveraging on existing genome scale models will be used to guide cell culture process control.

In this section, we consider metabolic steady state, i.e., metabolic state indicator has a fixed value, say $Z_{t}=0$ or $1$ representing growth phase or production phase. The indicator $Z_{t}$ represents the metabolic state on cellular level. For a fixed metabolic state, we will first develop a hybrid model for integrated regulation gene and metabolic networks. This hybrid model will take existing mechanistic and genome-scale models as prior and quantify process inherent stochasticity, including cell-to-cell flux rate variations and measurement errors. The dynamics and variations of cell culture process in either growth or production phase can be characterized by hybrid model parameters $\boldsymbol{\theta}$, which will vary cross different metabolic state. We will model the metabolic state shift in Section 3.1.

Sarah, we plan to consider this metabolic network network with gene expression as co-variate for associated flux rates; see Fig. 6. We have a few questions listed below.

• Most pathways in Fig. 6 are the similar to your iPSC paper. For new added pathways, could you recommend some reference papers that provide the reaction equations?

• Based on our understanding all the experiment measures in the paper [synoground2021transient] are extra-cellular concentrations, except the gene expression. Not sure if our understanding is correct.

• Since we only have very limited intra-cellular measurements, we may need to simplify some pathways that may not be critical to the specific problem (say ammonia stress). We can discuss it next meeting.

• Should we consider the state transition that can happen for cells from growth phase directly to death (The CHO cells are harvested at 8.5 days, which is relatively short period and cell viabilities are keep high ( 95%))?

• In the abstract of [synoground2021transient], you have the conclusion: “These results indicate that mechanisms used to alleviate ammonia stress are most likely controlled post-transcriptionally, and this is where future research should focus”. Does the word “post-transcriptionally” means that the alanine transaminase related gene Gpt2 did not have significantly different gene expression between different conditions and the flux rate of associated pathway is substrate-level controlled?

Built on our previous study on dynamic Bayesian network (DBN) based hybrid model leveraging on existing macro-kinetic models, we will further develop a multi-scale bioprocess probabilistic graphical model for cell culture process characterizing the spatial-temporal causal interdependencies at molecular, cellular, and system levels. To better represent the underlying generative process, the proposed bioprocess model has new features, including: (1) the graphical model has latent variables accounting for the fact that some species along the cellular pathways may not be observed or uniquely determined by data; and (2) state transition model can have a nonlinear regression trend depending on previous states,

$$\boldsymbol{s}_{t+1}=\boldsymbol{f}(\boldsymbol{s}_{t},\boldsymbol{a}_{t},\boldsymbol{v}_{t};\boldsymbol{\theta})$$ (1)

with $\boldsymbol{f}(\cdot)$ being a nonlinear function of state $\boldsymbol{s}_{t}$ and action $\boldsymbol{a}_{t}$. The random flux rates $\boldsymbol{v}_{t}$ depend on current and previous state (such as metabolite/substrate concentrations, gene expression).

• State variables $\boldsymbol{s}_{t}$: (1) environmental conditions (i.e., number of cells, cell density, viable cell density, pH, DO); (2) metabolites (i.e., Glucose, Lactate, Glutamine, Glutamate, IgG, Alanine ); and Glycan profiles; (3) gene expression (i.e., which genes related to which potiential metabolic network)

• Decision variables $\boldsymbol{a}_{t}$: Glucose and Glutamate feeding.

• Metabolic Network: The simplified metabolic network we considered in this paper is shown at Fig. 6 (A) along with glycolysis and the TCA cycle. We will take the gene expressions in Fig. 6 as covariates to the critical pathways associated to studying the cell response to ammonia stress.

Figure 3: Simplified central metabolic network with oxygen

A simple example is used to explain cellular kinetics and show how to develop the multi-scale bioprocess KG leveraging on existing genome scale model (Fig. LABEL:fig:Multi-scaleModeling-simpleExample). In the bioreactor, each cell serves as a factory consuming substrates and producing the terminal products and metabolites through a metabolic regulatory network composed of a series of linked molecular reactions (i.e., metabolic pathways) with structure specified by a stoichiometric matrix $N$. The cellular kinetics can be modelled as ${d(\boldsymbol{m}_{t},\boldsymbol{q}_{t},\boldsymbol{c}_{t})}/{dt}=N\boldsymbol{v}_{t}X_{t}$ with $\boldsymbol{v}_{t}$ and $X_{t}$ representing flux rates (i.e., molecular reaction rates in the metabolic network) and cell density. In this project, we will consider CHO cells that are the most commonly used host cells to produce biologics and their structure of metabolic reaction networks (see Fig. 2).

The proposed multi-scale bioprocess KG is a stochastic decision process (SDP) characterizing the interactions of system macrokinetics and metabolic/proteomic/genetic super-networks of living cells (Fig. 2 – 4). It studies the evolution of bioprocess state ${\boldsymbol{s}}_{t}=(\boldsymbol{p}_{t},\boldsymbol{g}_{t})$, including the physical state $\boldsymbol{p}_{t}$ of mass mixture with different species (e.g., proteins, metabolites) and the signal state $\boldsymbol{g}_{t}$ (i.e., gene expression), under the actions $\boldsymbol{a}_{t}$ at the integrated cell and process levels. The state transition model mainly includes three key parts below.

(1) Flux rate for cellular kinetics: $\boldsymbol{v}_{t}=\boldsymbol{h}(\boldsymbol{p}_{t},\boldsymbol{a}_{t},\boldsymbol{g}_{t^{-}})$. Given the cellular metabolic network structure, the flux rate vector $\boldsymbol{v}_{t}$ is modeled as latent random variable with distribution characterizing the cell line or cell-to-cell variation. At any time $t$, the flux rates depend on: a) bioprocessing conditions, which relies on the physical state $\boldsymbol{p}_{t}$ (e.g., protein/metabolite profile and concentrations) and action $\boldsymbol{a}_{t}$ (e.g., media formulation, feeding rate, pH); and b) gene expression $\boldsymbol{g}_{t^{-}}$ (i.e., RNA-seq). Since gene expression creates mRNA that sends the message to generate specific types of protein enzymes controlling the associate reaction flux rate, this procedure (represented by green arc in Fig. 4) has a time delay (denoted by $\boldsymbol{g}_{t^{-}}$). Since each $i$-th flux rate, denoted by $v_{i,t}$, can be associated with a set of genes, denoted by ${g}_{i,t^{-}}$, via gene-protein-reaction (GPR) rules, we will construct the time series model, ${v}_{i,t}=h_{i}({g}_{i,t^{-}})$; see Fig. LABEL:fig:Multi-scaleModeling-simpleExample.

Figure 4: Multi-scale bioprocess modeling how the metabolic/proteomic/genetic networks are wired.

(2) Gene expression evolution: $\boldsymbol{g}_{t+1}=\gamma(\boldsymbol{g}_{t},\boldsymbol{p}_{t},\boldsymbol{a}_{t})$, modeling that the unfriendly bioprocessing environment conditions (e.g., protein/metabolite concentrations, nutrient starvation, oxidation stress, toxicity, unfriendly pH) impacted by $(\boldsymbol{p}_{t},\boldsymbol{a}_{t})$ can cause clonal instability. We model the evolution of gene expression as $\boldsymbol{g}_{t+1}=\gamma(\boldsymbol{p}_{t},\boldsymbol{a}_{t},\boldsymbol{g}_{t})$.

(3) Intra- and extra-cellular physical state transition: $\boldsymbol{p}_{t+1}=\boldsymbol{f}(\boldsymbol{p}_{t},\boldsymbol{a}_{t},\boldsymbol{v}_{t};\boldsymbol{\theta})$. It depends on metabolic network flux rates and process kinetics.

Therefore, the spatial-temporal probabilistic causal interdependencies of cell culture stochastic decision process, accounting for wired metabolic/proteomic/genetic super-network of living cells, is characterized by the joint distribution,

$$p(\boldsymbol{\tau}|\boldsymbol{\theta})=\prod_{t=1}^{H-1}p(\boldsymbol{v}_{t}|\boldsymbol{p}_{t},\boldsymbol{a}_{t},\boldsymbol{g}_{t^{-}};\boldsymbol{\theta})p(\boldsymbol{p}_{t+1}|\boldsymbol{p}_{t},\boldsymbol{a}_{t},\boldsymbol{v}_{t};\boldsymbol{\theta})p(\boldsymbol{g}_{t+1}|\boldsymbol{g}_{t},\boldsymbol{p}_{t},\boldsymbol{a}_{t};\boldsymbol{\theta})p(\boldsymbol{p}_{1},\boldsymbol{g}_{1};\boldsymbol{w})p(\boldsymbol{a}_{t}),$$ (2)

where the operation actions $\boldsymbol{a}_{t}$ (e.g., cell genome, media formulation and feeding strategy influencing gene expression and reaction rates) are selected to control the bioprocess trajectories $\boldsymbol{\tau}$.

3.1 Metabolic State Shift Model Development

We plan to leverage the experimental data similar to the study in [synoground2021transient]. For example, the different phases are defined as: exponential growth phase (Days 0 – 4.5) and specific productivity (Days 0.5 – 8.5). In our paper, we do not know the exact state transition and build a hybrid model to improve the prediction.

We will create a metabolic state shift hybrid model to improve the prediction and facilitate the KG-IS based data reuse for the prediction. Keqi will conduct the literature review to facilitate the hybrid model development for metabolic state shift, including

• the list of co-factors (such as Nitrogen);

• the mechanistic model structure information.

If there is no specific structure information, we may consider logic regression to model the metabolic state transition probability. Further, built on the existing prior knowledge, we can utilize the data to estimate the key factors and environmental conditions that contribute the most to the metabolic state shift.

When the metabolic shift happens, the cell will change the regulatory metabolic network of the host cell in terms of changing metabolic flux rates and gene expression levels. Building on the multi-scale bioprocess KG proposed in Section LABEL:subsec:multi-scaleProcess, we will introduce a latent state indicator, denoted by $\{Z_{t}\}$, representing the underlying metabolic state; for example $Z_{t}=0,1,2$ represent cells in growth phase, production phase, and death.

Cells in the late stages of their growth in a fed-batch culture sometimes switch their metabolism from lactate production to low lactate production or lactate consumption [young2013metabolic, templeton2013peak, ma2009single, mulukutla2012metabolic]. However, such a shift in metabolism is not a consistent occurrence; under seemingly similar conditions, some cultures switch their metabolism and consume lactate while others continue to produce lactate at high rates [mulukutla2015multiplicity].

Since the cell culture process dynamics and variations depend on the metabolic state, we will develop a new probabilistic knowledge graph with latent metabolic state indicator, denoted by $Z_{t}$, following a hybrid Markov process, i.e., the metabolic state shift probability depending on environmental conditions ($\boldsymbol{s}_{t}$). The cell culture process in different phases has different hybrid model parameters to represent the regulation metamoblic and gene network change; see Fig. 5. That means we have unknown parameters $\boldsymbol{\theta}_{0}$ and $\boldsymbol{\theta}_{1}$ for growth and production phases $Z=0,1$. The indicator $Z_{t}$ represents the metabolic state on cellular level.

Figure 5: The gene and metabolic regulation networks change during the metabolic state shift. We model the probabilistic function of individual cell metabolic shift which depends on the environmental stress.

(1) Phase-based Cell Growth. For each single cell, at any given time $t$, there exists a specific probability denoted as $p_{ij,t}$ that the cell’s metabolic state transitions from the $i$-th state to the $j$-th state, for $i,j\in\{0,1,2\}$. This probability is influenced by various environmental conditions, such as oxygen uptake rate, processing time, and the concentrations of lactate, glutamine, and ammonia.

A sigmoid function can be used to model the state transition probability. For example, it can represent the probability of transitioning from the exponential growth phase to the stationary phase at time $t$, denoted as $p_{01,t}$. To account for the delayed effects of environmental variations on cell behavior, this probability relies on both the current environmental state and several historical states, specifically ${\boldsymbol{s}_{t},\boldsymbol{s}_{t-1},\dots,\boldsymbol{s}_{t-h}}$, where $h$ denotes the longest time period during which these impacts persist. Incorporating this historical information allows the model to capture the impact of past system states on the cell metabolic state transition:

$$p_{01,t}=\frac{1}{1+exp^{-(\beta_{0}+\beta_{1}\times t+\beta_{2}\times v_{ELAC,t-1}+\beta_{3}\times v_{EGLN,t-1}+\beta_{4}\times v_{NH_{4},t-1}+\beta_{5}\times OTR_{t-1}}},$$ (3)

where consumption rate/production rate of extracellular Lactate $v_{ELAC}=v_{3}$, Glutamine $v_{EGLN}=v_{14}$, Ammonia $v_{NH_{4}}=v_{7}+v_{14}+v_{15}+v_{17}$, and $OTR_{t-1}$ represents the oxygen transfer rate at time $t-1$. Let $X_{0,t}$, $X_{1,t}$, and $X_{2,t}$ denote the cell densities at each phase at time $t$ for exponential growth phases, stationary phase, and death phase, respectively.

In the system-level perspective, the dynamics of the $i$-th phase cell density can be modeled as follows:

$$X_{i,t+1}=\sum_{k\in\{0,1,2\}}p_{ki,t+1}\times X_{k,t}e^{v^{k}_{21}\times\Delta t},$$ (4)

for $i\in\{0,1,2\}$, where $v^{k}_{21}$ represents the cell growth rate at the $k$-th phase. The second term, $X_{k,t}e^{v^{k}_{21}\times\Delta t}$, characterizes the growth behavior of the cell population at the $k$-th phase, considering the elapsed time interval $\Delta t$. The first term, $p_{ki,t+1}$, models the proportion of cells transitioning from the $k$-th phase to the $i$-th phase at time $t+1$. This dynamic model allows us to analyze and predict how cell densities evolve over time as cells transition between different phases. The growth rate $v(growth_{k})$ is represented as a function of environmental conditions, using the MM (Michaelis-Menten) form of the biomass synthesis rate equation as follows:

$$v^{k}_{21}=v^{k}_{max,21}\times\frac{EGLN}{K^{k}_{m,EGLN}+EGLN}\times\frac{EGLC}{K^{k}_{m,EGLC}+EGLC}\times\frac{EGLU}{K^{k}_{m,EGLU}+EGLU}\times\frac{EALA}{K^{k}_{m,EALA}+EALA}\times\frac{EASP}{K^{k}_{m,EASP}+EASP}\times\frac{ESER}{K^{k}_{m,ESER}+ESER}$$ (5)

(2) Metabolic Reaction Network Stochastic Model. The extracellular metabolite concentrations at time $t$ are denoted by a vector with dimension $p$, i.e., $\boldsymbol{s}(t)=\big{(}s_{1}(t),s_{2}(t),\dots,s_{p}(t)\big{)}^{\top}$. Similarly, the intracellular metabolite concentrations of interest are denoted by a vector with dimension $q$ at time $t$ as $\boldsymbol{\ell}(t)=\big{(}\ell_{1}(t),\ell_{2}(t),\dots,\ell_{q}(t)\big{)}^{\top}$. Thus, at any time $t$, the state of extracellular and intracellular metabolite concentrations is denoted by

$$\boldsymbol{u}(t)=\big{(}\boldsymbol{s}(t)^{\top},\boldsymbol{\ell}(t)^{\top}\big{)}^{\top}.$$

To model the dynamic evolution of cell response to environmental perturbation during the CHO cell culture process, at any time $t$, the specific reaction flux rates of $z$-th phase ($z=0,1$ represent growth and production phase separately) represented by a vector of with dimension $n$ depend on the extracellular and intracellular metabolite concentrations, i.e.,

$$\boldsymbol{v}^{z}[\boldsymbol{u}(t)]=\big{(}v_{1}^{z}[\boldsymbol{u}(t)],v_{2}^{z}[\boldsymbol{u}(t)],\dots,v_{n}^{z}[\boldsymbol{u}(t)]\big{)}^{\top}.$$

Let $N$ denote a $(p+q)\times n$ stoichiometry matrix characterizing the structure of the metabolic reaction network with $(p+q)$ denoting the dimension of species or state $\boldsymbol{u}_{t}$. The $(i,j)$-th element of $\boldsymbol{N}$, denoted as $\boldsymbol{N}(i,j)$, represents the number of molecules of the $i$-th species that are either consumed (indicated by a negative value) or produced (indicated by a positive value) in each random occurrence of the $j$-th reaction. Consequently, during the time interval $[t,t+\Delta t]$, the change in the cell culture characteristics are derived as:

$${\mathbf{u}}_{t+\Delta t}={\mathbf{u}}_{t}+\sum_{z=0}^{1}\boldsymbol{N}\cdot\boldsymbol{R}^{z}_{\Delta t}X^{z}_{t},$$

where $\boldsymbol{R}^{z}_{\Delta t}$ is a $n$-dimensional vector representing the $z$-th phase single-cell level accumulated number of occurrences of each reaction $k$ until time $t+{\Delta t}$ for $k\in\{1,\dots,n\}$, i.e., $\boldsymbol{R}_{\Delta t}=(R^{1}_{\Delta t},R^{2}_{\Delta t},R^{3}_{\Delta t},\dots,R^{n-1}_{\Delta t},R^{n}_{\Delta t})^{\top}$, and $\sum_{z=0}^{1}\boldsymbol{N}\cdot\boldsymbol{R}^{z}_{\Delta t}X^{z}_{t}$ represents the net amount of the reaction outputs up to time $t+{\Delta t}$ from time $t$ in the system level.

• Option 1. Inspired by [anderson2011continuous, wang2023stochastic], we assume that the occurrence times $R^{k}_{t}$ for each reaction $k$ follows a nonhomogeneous Poisson process, which is a special type of counting process. The intensity of this process is determined by the reaction rates. Therefore, the probability that the $k$-th reaction occurs $r$ times during time interval $(t,t+\Delta t]$ becomes,

  $$P\left(R^{k}_{t+\Delta t}-R^{k}_{t}=r\right)=\sum_{z=0}^{1}\frac{e^{-\int_{t}^{t+\Delta t}v^{z}_{k}(\boldsymbol{u}_{x})dx}(\int_{t}^{t+\Delta t}v^{z}_{k}(\boldsymbol{u}_{x})dx)^{r}}{r!}\triangleq\sum_{z=0}^{1}\text{Poisson}\left(\int_{t}^{t+\Delta t}v^{z}_{k}(\boldsymbol{u}_{x})dx\right).$$ (6)

  The standard deviation of each flux under a Poisson process is equal to the mean, which may be excessively large for real data.

• Option 2. The dynamic evolution of extracellular and intracellular metabolite concentrations is modeled through the stochastic differential equations (SDE),

  $$d\boldsymbol{u}(t)=\sum_{z=0}^{1}\boldsymbol{N}\boldsymbol{v}^{z}[\boldsymbol{u}(t)]X^{z}(t){dt}+\sum_{z=0}^{1}\boldsymbol{N}\boldsymbol{\sigma}^{z}[\boldsymbol{u}(t)]X^{z}(t){dW_{t}},$$ (7)

  where ${W_{t}}$ denotes a Wiener process (standard Brownian motion). To simplify the model, assume that the standard deviation is proportional to the mean, denoted as $\boldsymbol{\alpha}$. i.e., $\boldsymbol{\sigma}^{z}=\boldsymbol{\alpha}\boldsymbol{v}^{z}$.

• Option 3. Consider the presence of measurement error will make $\boldsymbol{u}$ as latent state, which makes the inference much more complex. Ignore at this point.

To capture the cell response to environmental perturbation, a Michaelis–Menten (MM) formalism-based regulation model was used to characterize the relationship of metabolic flux rates depending on the concentrations of associated substrates and inhibitors. This allows leveraging the existing biology knowledge and facilitating the learning of regulation mechanisms of CHO cell metabolic reaction network from the experimental data.

Specifically, the $g$-th flux rate at the time $t$ is modeled as,

$$v_{g}[\boldsymbol{u}(t)]=v_{max,g,f}\prod_{y\in\Omega^{g,f}_{Y}}\frac{u_{y}(t)}{u_{y}(t)+K_{m,y}}\prod_{z\in\Omega^{g,f}_{Z}}\frac{K_{i,z}}{u_{z}(t)+K_{i,z}}-v_{max,g,r}\prod_{y\in\Omega^{g,r}_{Y}}\frac{u_{y}(t)}{u_{y}(t)+K_{m,y}}\prod_{z\in\Omega^{g,r}_{Z}}\frac{K_{i,z}}{u_{z}(t)+K_{i,z}},$$ (8)

for $g=1,2,\ldots,n$, where $v_{max,g,f}$ and $v_{max,g,r}$ are defined as positive values representing the maximal flux rates from substrates to products (forward) and vice versa (backward), the sets $\Omega^{g,f}_{Y}$ and $\Omega^{g,r}_{Y}$ represent the collection of activators (such as nutrients and substrates) influencing the forward and backward flux rates, while the sets $\Omega^{g,f}Z$ and $\Omega^{g,r}Z$ represent the collection of inhibitors dampening forward and backward reactions. The parameters $K{i,\cdot}$ and $K{m,\cdot}$ represent the affinity constant and the inhibition constant, respectively.

Therefore, this study can address the critical industry needs: (1) integrating the data collected from cells with different metabolic states; (2) guiding anomaly detection (such as cell differentiation to other metabolic states), and (3) classifying cells based on metabolic state and functional behaviors.

According to [szeliova2020cho], biomass composition was estimated to be 22.1% RNA, 11.0% DNA, 6.9% carbohydrate,50.5% protein, and 19.2%lipid, mol/mol. RNA composition was estimated to be 27% ATP, 26% GTP, 22%UTP, and 25%CTP, mol/mol. DNA composition was estimated to be 29% dATP, 21% dGTP,29% dTTP, and 21% dCTP,mol/mol. Lipid composition was estimated to be 26% cholesterol, 59% phospholipid, and 15% sphingolipid, mol/mol. Regarding the antibody, the amino acid (AA) chain of VRC01 is obtained by converting the DNA sequence provided in [synoground2021transient]. A molecular weight of 54375 /mol was calculated based on the weighted average of the molecular weights of the component amino acids. Based on the measured dry cell weight of 240pg/cell, it was determined that $1\times 10^{6}$ cells/mL is equivalent to 2.31mM biomass. It was determined that 1g/L antibody is equivalent to 7.94mM antibody.

VRC01 light chain (687 bp): ATGAAGTGGGTGACCTTCATCTCCCTGCTGTTTCTGTTCTCCAGCGCCTACTCCGAGATCGTGCTGACCCAGTCCCCCGGCACCCTGTCCCTGAGTCCCGGCGAGACAGCCATCATCAGCTGCCGGACCTCCCAGTACGGCTCCCTGGCCTGGTATCAGCAGAGGCCAGGCCAGGCCCCTCGGCTGGTCATCTACTCCGGCTCTACCCGGGCTGCTGGCATCCCTGACCGGTTCTCTGGCTCCAGATGGGGCCCTGACTACAACCTGACCATCTCCAACCTGGAATCCGGCGACTTCGGCGTGTACTACTGCCAGCAGTACGAGTTCTTCGGCCAGGGCACCAAGGTGCAGGTGGACATCAAGCGGACCGTGGCCGCTCCCTCCGTGTTCATCTTCCCACCCTCCGACGAGCAGCTGAAGTCCGGCACCGCCTCCGTGGTCTGCCTGCTGAACAACTTCTACCCCCGCGAGGCTAAGGTGCAGTGGAAGGTGGACAACGCCCTGCAGTCCGGCAACTCCCAGGAATCCGTCACCGAGCAGGACTCCAAGGACAGCACCTACTCCCTGTCCTCCACCCTGACCCTGTCcAAgGCCGACTAcGAGAAGCACAAGGTGTAcGCCTGCGAAGTGACCCACCAGGGCCTGTCCAGCCCCGTGACCAAGTCCTTCAACCGGGGCGAGTGCTGA VRC01 heavy chain (1,407 bp): ATGAAGTGGGTGACCTTCATCTCCCTGCTGTTTCTGTTCTCCAGCGCCTACTCCCAGGTGCAGCTGGTGCAGTCTGGCGGCCAGATGAAGAAACCCGGCGAGTCCATGCGGATCAGCTGCCGGGCCTCCGGCTACGAGTTCATCGACTGCACCCTGAACTGGATCAGACTGGCCCCTGGCAAGCGGCCCGAGTGGATGGGCTGGCTGAAGCCTAGAGGCGGCGCTGTGAACTACGCCAGACCTCTGCAGGGCAGAGTGACCATGACCCGGGACGTGTACTCCGATACCGCCTTTCTGGAACTGCGGAGCCTGACCGTGGACGATACCGCCGTGTACTTCTGCACCCGGGGCAAGAACTGCGACTACAACTGGGACTTCGAGCACTGGGGCAGAGGCACCCCCGTGATCGTCAGCTCCGCCTCCACCAAGGGCCCCTCCGTGTTCCCTCTGGCCCCCTCCAGCAAGTCCACCTCTGGCGGCACCGCTGCCCTGGGCTGCCTGGTGAAAGACTACTTCCCCGAGCCTGTGACCGTGTCCTGGAACTCTGGCGCCCTGACCTCCGGCGTGCACACCTTCCCTGCCGTGCTGCAGTCCTCCGGCCTGTACTCCCTGTCCTCCGTGGTGACAGTGCCCTCCTCCAGCCTGGGCACCCAGACCTACATCTGCAACGTGAACCACAAGCCCTCCAACACCAAGGTGGACAAGCGGGTGGAACCCAAGTCCTGCGACAAGACCCACACCTGTCCCCCCTGCCCTGCTCCTGAGCTGCTGGGCGGACCTTCCGTGTTCCTGTTCCCCCCAAAGCCCAAGGACACCCTGATGATCTCCCGGACCCCCGAAGTGACCTGCGTGGTGGTGGACGTGTCCCACGAGGACCCTGAAGTGAAGTTCAATTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGaGAgGAaCAGTAcAACTCCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAAGAGTACAAGTGCAAGGTCTCCAACAAGGCCCTGCCTGCCCCCATCGAAAAgACcATCTCcAAGGCCAAGGGCCAGCCCCGCGAGCCCCAGGTGTACACACTGCCCCCTAGCCGGGAAGAGATGACCAAGAACCAGGTGTCCCTGACCTGTCTGGTGAAAGGCTTCTAcCCcTCCGACATTGCCGTGGAATGGGAGTCCAAcGGcCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACTCCGACGGCTCATTCTTCCTGTACTCCAAGCTGACAGTGGACAAGTCCCGGTGGCAGCAGGGCAACGTGTTCTCCTGCTCCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGTCCCTGAGCCCCGGCTGA

VRC01 heavy chain: MKWVTFISLLFLFSSAYSEIVLTQSPGTLSLSPGETAIISCRTSQYGSLAWYQQRPGQAPRLVIYSGSTRAAGIPDRFSGSRWGPDYNLTISNLESGDFGVYYCQQYEFFGQGTKVQVDIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC. VRC01 heavy chain: MKWVTFISLLFLFSSAYSQVQLVQSGGQMKKPGESMRISCRASGYEFIDCTLNWIRLAPGKRPEWMGWLKPRGGAVNYARPLQGRVTMTRDVYSDTAFLELRSLTVDDTAVYFCTRGKNCDYNWDFEHWGRGTPVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG.

In this paper, the well-stirred assumption is employed, which entails disregarding variations among cells within the same group (e.g., cells in the growth phase). The primary focus here is on the heterogeneity originating from cells in different groups, referred to as “between-group variation”. Different groups of cells exhibit diverse dynamics and variations in metabolic flux rates. The “within-group variation” becomes even more pertinent when transitioning to aggregate cultures. In these scenarios, cells are distributed spatially across diverse regions within aggregates, and each of these regions is exposed to unique micro-environmental conditions.

We use a mixture distribution of stochastic decision processes to model the dynamic evolution of heterogeneous cells with different metabolic states. Specifically, we model the variation of cells in the same group (such as cell in growth phase) as in-group variation and cells in different groups as between-group variation. Different groups of cells have different dynamics and variations on metabolic flux rates. This idea can be extended to iPS cell cultures for heterogeneous cells that are spatially located in different places of aggregates and they have different micro-environmental conditions.

Remark: Even though we may end up with a similar mixture structure to the literature paper “Dynamic metabolic models of CHO cell cultures through minimal sets of elementary flux modes” (Keqi, please add the reference paper), the advantages of our proposed hybrid metabolic state transition include: (1) A hybrid model with a state-transition model can guide interpretable decision-making; (2) facilitate mechanism learning, i.e., how the cell culture conditions impact on metabolic state shift; (3) supports robust process control

3.2 Regulatory Metabolic Network Modeling

Table 1: Reactions of the metabolic network

No.	Pathway
1	EGLC $\rightarrow$ G6P
2	G6P $\rightarrow$ 2 PYR
3	PYR $\leftrightarrow$ LAC
4	LAC $\leftrightarrow$ ELAC
5	GLU + PYR $\leftrightarrow$ AKG + ALA
6	ALA $\rightarrow$ EALA
7	SER $\rightarrow$ PYR + NH4
8	ESER $\rightarrow$ SER
9	PYR $\rightarrow$ AcCoA + CO2
10	AcCoA + OAA $\rightarrow$ AKG +CO2
11	AKG $\rightarrow$ SUC + CO2
12	SUC $\rightarrow$ MAL + CO2
13	MAL$\rightarrow$ OAA
14	MAL $\rightarrow$ PYR + CO2
15	EGLN $\rightarrow$ GLN
16	GLN $\leftrightarrow$ GLU + NH4
17	GLU $\leftrightarrow$ AKG + NH4
18	GLU $\rightarrow$ EGLU
19	ASP + AKG $\leftrightarrow$ GLU + OAA + NH4
20	EASP $\rightarrow$ ASP
21	LEU + AKG $\rightarrow$ GLU + 3 AcCoA
22	ELEU $\rightarrow$ LEU
23	VAL + AKG $\rightarrow$ GLU + SUC + CO2
24	EVAL $\rightarrow$ VAL
25	ILE + AKG $\rightarrow$ GLU + SUC + AcCoA
26	EILE $\rightarrow$ ILE
27	66 EALA + 56 EASP + 62 EGLN + 68 EGLU + 166 ESER + 108 ELEU + 38 EILE + 122 EVAL$\rightarrow$ ANTI
28	ANTI $\rightarrow$ EANTI
29	0.4 EALA + 0.26 EASP + 0.33 EGLN + 0.33 EGLU + 0.35 ESER + 0.42 LEU + 0.19 ILE + 0.26 EVAL + 0.11 EGLC $\rightarrow$ BIOM
30	BIOM $\rightarrow$ EBIOM

Table 2: Biokinetic equations of the metabolites fluxes of the model

No.	Pathway
2	$v_{2}=v_{max,2}\times\frac{EGLC}{K_{m,EGLC}+EGLC}\times\frac{K_{i,ELACtoHK}}{K_{i,ELACtoHK}+ELAC}\times\frac{K_{i,ELEUtoHK}}{K_{i,ELEUtoHK}+ELEU}$
3	$v_{3}=v_{max,3f}\times\frac{EGLC}{K_{m,EGLC}+EGLC}\times\frac{EGLN}{K_{m,EGLNtoLDH}+EGLN}-v_{max,3r}\times\frac{ELAC}{K_{m,ELAC}+ELAC}$
5	$v_{5}=v_{max,5f}\times\frac{EGLC}{K_{m,EGLC}+EGLC}-v_{max,5r}\times\frac{EALA}{K_{m,EALA}+EALA}$
7	$v_{7}=v_{max,7}\times\frac{ESER}{K_{m,ESER}+ESER}$
16	$v_{16}=v_{max,16f}\times\frac{EGLN}{K_{m,EGLN}+EGLN}\times\frac{K_{i,ELACtoGLNS}}{K_{i,ELACtoGLNS}+ELAC}-v_{max,16r}\times\frac{EGLU}{K_{m,EGLU}+EGLU}\times\frac{NH_{4}}{K_{m,NH_{4}}+NH_{4}}$
17	$v_{17}=v_{max,17f}\times\frac{EGLU}{K_{m,EGLU}+EGLU}-v_{max,17r}\times\frac{NH_{4}}{K_{m,NH_{4}}+NH_{4}}$
19	$v_{19}=v_{max,19f}\times\frac{EASP}{K_{m,EASP}+EASP}-v_{max,19r}\times\frac{EGLU}{K_{m,EGLU}+EGLU}\times\frac{NH_{4}}{K_{m,NH_{4}}+NH_{4}}$
21	$v_{21}=v_{max,21}\times\frac{ELEU}{K_{m,ELEU}+ELEU}$
23	$v_{23}=v_{max,23}\times\frac{EVAL}{K_{m,EVAL}+EVAL}$
25	$v_{25}=v_{max,25}\times\frac{EILE}{K_{m,EILE}+EILE}$
27	$v_{27}=v_{max,27}\times\frac{EGLN}{K_{m,EGLN}+EGLN}\times\frac{EGLU}{K_{m,EGLU}+EGLU}\times\frac{EALA}{K_{m,EALA}+EALA}\times\frac{EASP}{K_{m,EASP}+EASP}\times\frac{ESER}{K_{m,ESER}+ESER}\times\frac{ELEU}{K_{m,ELEU}+ELEU}\times\frac{EILE}{K_{m,EILE}+EILE}\times\frac{EVAL}{K_{m,EVAL}+EVAL}$
29	$v_{29}=v_{max,29}\times\frac{EGLN}{K_{m,EGLN}+EGLN}\times\frac{EGLC}{K_{m,EGLC}+EGLC}\times\frac{EGLU}{K_{m,EGLU}+EGLU}\times\frac{EALA}{K_{m,EALA}+EALA}\times\frac{EASP}{K_{m,EASP}+EASP}\times\frac{ESER}{K_{m,ESER}+ESER}\times\frac{ELEU}{K_{m,ELEU}+ELEU}\times\frac{EILE}{K_{m,EILE}+EILE}\times\frac{EVAL}{K_{m,EVAL}+EVAL}$

Section 3.2.1 presents the mammalian cell metabolic reaction network which includes central carbon metabolism. In Section 3.2.2, metabolic flux kinetics, characterizing cell response to environmental variations, were learned from time-course extracellular concentration measurements.

3.2.1 Metabolic Reaction Network

The developed mammalian cell metabolic network model leverages central carbon metabolism from several previously published metabolic frameworks [ghorbaniaghdam2014silico, ghorbaniaghdam2013kinetic, nolan2011dynamic] and further learns from data. The metabolic network included glycolysis (high), TCA cycle (low), anaplerosis, and amino acid metabolism (high). Branched-chain amino acids (BCAAs), namely leucine, isoleucine, and valine, were also incorporated in the study. BCAAs play a dual role, serving as substrates for protein synthesis and simultaneously exerting a stimulatory effect on protein synthesis while inhibiting proteolysis. These effects are mediated by BCAAs themselves, with a particular emphasis on leucine, and their metabolites. Leucine, for instance, enhances protein synthesis through the mammalian target of rapamycin (mTOR) signaling pathway and the phosphorylation of translation initiation factors and ribosomal proteins [holevcek2018branched, nair2005hormonal]. The metabolic network is shown in Fig. 6 and the metabolic stoichiometry is listed in Table 1. For simplification, the BCAA-related reactions were collapsed based on studies [salcedo2021functional, mann2021branched, crown2015catabolism]. The descriptions of metabolites and the enzymes conform to the Enzyme Commission Number (EC-No.) and are provided in Tables LABEL:tab:metabolite and  LABEL:tab:enzyme, respectively.

Figure 6: Schematic of the CHO Metabolic Reaction Network, with metabolites in green and blue representing extracellular and intracellular locations, respectively. Red highlights indicate reactions with flux rates modeled using Michaelis-Menten (M-M) kinetics based on extracellular metabolite concentrations.

3.2.2 Flux Regulation Mechanistic Model

Building upon the insights provided by reference [nolan2011dynamic], this paper employs Michaelis-Menten (MM) kinetics to characterize the flux rate of cytosolic intracellular enzyme-catalyzed reactions, with concentration dependencies determined by the associated extracellular metabolite concentrations. Within this formulation, the uptake rate for a given extracellular metabolite is regulated by multiple intracellular reactions, rather than relying on a single transporter.

Several regulatory mechanisms (i.e., No. R1 to R4) are highlighted in Fig. 6, which were incorporated into the metabolic flux kinetics model to improve the model’s prediction capability and better characterize the responses to environmental variations. These key final reactions are described below, where these new dependencies are highlighted in under brackets $\underbrace{\dots\dots}$ with the corresponding regulatory mechanism No., while the original nomenclature is outside the brackets.

• Lactate accumulation has previously been reported to reduce glycolytic activity by inhibiting hexokinase (HK) and phosphofructokinase (PFK) activity in mammalian cells, where lactate acts as a signaling molecule to down-regulate PFK activity [ivarsson2015insights, mulukutla2012metabolic, costa2007lactate]. The model for HK was updated to include this inhibitory effect of lactate on it:

  $$v_{2}=v_{max,2}\times\frac{EGLC}{K_{m,EGLC}+EGLC}\times\underbrace{\frac{K_{i,ELACtoHK}}{K_{i,ELACtoHK}+ELAC}}_{\textbf{R1}}.$$ (9)

• Since lactate inhibits glutaminase activity – the enzyme responsible for converting glutamine (GLN) to glutamate (GLU) [glacken1988mathematical, hassell1991growth] – the forward ($f$) flux rate for the reaction, i.e., GLN $\leftrightarrow$ GLU + NH₄, was updated,

  $$v_{16}=v_{max,16f}\times\frac{EGLN}{K{m,EGLN}+EGLN}\times\underbrace{\frac{K_{i,ELACtoGLNS}}{K_{i,ELACtoGLNS}+ELAC}}_{\textbf{R2}}-v_{max,16r}\times\frac{EGLU}{K_{m,EGLU}+EGLU}\times\frac{NH_{4}}{K_{m,NH_{4}}+NH_{4}}.$$ (10)

• Need further think. During glutaminolysis, glutamine is converted into $\alpha$-ketoglutarate, which can be used as an intermediate in the TCA cycle. As a result, glutamine can indirectly contribute the glycolytic pathway by providing carbon to pyruvate and, subsequently, lactate. Thus, the flux rate model of lactate production rate was updated as:

  $$v_{5}=v_{max,5f}\times\frac{EGLC}{K_{m,EGLC}+EGLC}\times\underbrace{\frac{EGLN}{K_{m,EGLNtoLDH}+EGLN}}_{\textbf{R3}}-v_{max,5r}\times\frac{EALA}{K_{m,EALA}+EALA}$$ (11)

• No significant Improvement Mechanism of BCAAs and fatty acids regulating energy metabolism. BCAAs and fatty acids affect mitochondrial energy metabolism through different mechanisms in different cells. In mouse heart perfusate, BCAAs inhibited the activity of pyruvate dehydrogenase [li2017defective]. In muscle cells, the increased citrate inhibits the accumulation of phosphofructokinase and glucose-6-phosphate [savage2007disordered]. In liver cells, BCKAs can directly suppress the expression of respiratory complex II/SDH to reduce the production of ATP [wang2019bcaa].

A complete description of the final model can be found in Table 2.

4 Model Inference and Risk-based Prediction

The proposed CHO cell culture kinetic model estimates model parameters using the extracellular over time. Denote the available extracellular metabolites concentrations data at time $t$ as $s_{t}^{meas}$ for $t=0,1,\dots,14$ day. For the model fitting, the objective is minimizing the weighted sum of squared residuals (SSR) between available experimental data ($s_{t}^{meas}$) and model predicted values ($s_{t}^{sim}$),

$$\min\mbox{SSR}=\sum_{t=1}^{T}\frac{(s_{t}^{sim}-s_{t}^{meas})^{2}}{var_{t}^{s}},$$ (12)

where the weights are the inverse of the variances of the experimental measurements on extracellular metabolites, i.e., ($var_{t}^{s}$). The fitting criteria in eq (12) allows the model to systematically and effectively fit the metabolic regulation network at different times.

Figure 7: Cell characteristic predictions for Tigr 15 BR 1 using the dynamic model trained on the other data sets. (A) Cell density, (B) Glucose, (C) Lactate, (D) Glutamine, (E) Glutamate, and (F) IgG.

Tigr 15 and Tigr 20 display varying characteristics in lactate consumption rate, glutamine consumption rate, and IgG production rate, despite both control series being designed to be consistent. We require additional analysis to understand this phenomenon better. Some potential factors contributing to this include:

• The initial concentration of glutamine.

• The omission of certain amino acids from the model.

• The accumulation of inhibitors due to specific amino acids.

Further investigation is needed to clarify these factors.

• Based on the data collected from Tigr15 and Tigr20, it is evident that the feeding strategy for branched-chain amino acids (BCAA), particularly isoleucine and valine, differs significantly. This difference may be attributed to differences in the concentration of these amino acids in the feeding solutions. This difference in feeding methods might explain why Tigr15 ended up with higher final titers compared to Tigr20.

• 2-hydroxyisocaproic acid (HICA) and Methyl-succinic acid (MSA) can be categorized as arising from branched-chain amino acids (BCAA), including isoleucine, leucine, and valine. HICA is the breakdown product of leucine, while MSA forms from the isomerization of isoleucine. Both compounds exhibited toxicity towards growth, with HICA displaying slightly higher toxicity compared to MSA.

2-hydroxyisocaproic acid (HICA), Methyl-succinic acid (MSA), Aconitic acid (ACA), Cytidine monophosphate (CMP), Guanosine monophosphate (GMP), Trigonelline (TRI), N-acetyl putrescine (NAP) are the metabolites under investigation.

Among these, CMP, GMP, and ACA (aconitate) are recognized to accumulate through pathways originating from central carbon metabolism, such as the TCA cycle, purine, and pyrimidine metabolism.

Lastly, TRI and NAP are by-products of nicotinate and arginine metabolism, respectively, and were observed to be toxic to cells even at lower concentrations.

4.1 Toward simplified model: reduction of model parameters

A mathematical model should provide mechanistic insights into the system under investigation. Furthermore, for the model to be considered adequate, it is desirable to have a minimal number of model parameters [kastelic2019dynamic].

4.2 Specific consumption rates and specific productivity calculations

Deterministic specific consumption and production rates were estimated. Measured metabolite, including glucose, amino acids and ammonia, concentrations were treated as the dependent variable, adjusted for feeding. Integral viable cell density (IVCD), calculated according to [pan2017selection] was treated as the independent variable. [brodsky2019high] is another option.

The CHO cell growth equation at $i$-th sampling point is:

$$X_{i}=X_{i-1}e^{\mu(t_{i}-t_{i-1})},$$ (13)

where $\mu$ is the specific growth rate, $X_{i}$ and $X_{i-1}$ (cells $\cdot$ mL^-1) are the viable cell densities of the last and the current sampling points respectively. $t_{i-1}$ and $t_{i}$ (hour) are the time points for the last and the current sampling points, respectively. Then the integral viable cell density (IVCD) was calculated by:

$$\Delta IVCD_{i}=X_{i-1}\times(t_{i}-t_{i-1})+\frac{(X_{i}-X_{i-1})\times(t_{i}-t_{i-1})}{2}$$ (14)

The specific metabolite consumption/production rate, $q^{m}$ for $m=1,\ldots,M$ (mmol$\times$cell^-1h^-1) can then be calculated by:

$$\frac{\Delta m_{i}}{\Delta IVCD_{i}}=q^{m}_{i}$$ (15)

5 Empirical Study

Glycolysis: The glycolytic pathway was found to be enriched in the growth phase (GSEA). TCGSA suggested that glycolytic gene sets exhibit significant temporal perturbation or dynamics. Glycolytic metabolites such as glucose-6-phosphate (G6P) and fructose-6-phosphate (F6P) serve as precursors to the NSD biosynthetic pathways. Therefore, changes in the transcript levels of glycolytic enzymes and in the corresponding metabolites can potentially influence the flux directed toward NSD biosynthesis. Glucose consumption rates ($v_{Glc}$) and lactate production rates ($v_{Lac}$) have been used as indicators of the dynamics in central energy metabolism. For both processes, the metabolic state of the cells in the bioreactors shifted from lactate-producing ($\frac{v_{Lac}}{v_{Glc}}>0$) to lactate-consuming state ($\frac{v_{Lac}}{v_{Glc}}<0$) and again to a marginally lactate-producing state toward the end of the culture. Such metabolic shifts are known to be outcomes of changes in the glycolytic gene expression and intermediate metabolite levels. Several glycolytic enzymes, including ADP-dependent glucokinase (ADPGK), 6-phosphofructo-2-kinase (PFKFB4), triosephosphate isomerase (TPI), hexokinase-2 (HK2), and fructose bisphosphate aldolase C (ALDOC), changed significantly over time. Similarly, metabolites such as lactate, dihydroxyacetone phosphate, hexose diphosphates, and pyruvate were also found varying significantly with time.

TCA Cycle: The tricarboxylic citric acid (TCA) cycle is directly linked to glycolysis, glutamine, and purine and pyrimidine metabolic pathways. Several gene sets related to the TCA cycle were enriched in the growth phase. These gene sets also exhibited significant time dynamics. The levels of several genes including those encoding for fumarate hydratase (FH), ATP citrate synthase (ACLY), NADP-dependent malic enzyme (ME1), and succinate dehydrogenase (SDHC) varied over time. Interestingly, although the TCA cycle did not show up in TCMSA analysis, a few of its metabolites including aconitate, citrate, and malate were either up- or downregulated over time.