Protein-Mamba: Biological Mamba Models for Protein Function Prediction

Abstract

Protein function prediction is a pivotal task in drug discovery, significantly impacting the development of effective and safe therapeutics. Traditional machine learning models often struggle with the complexity and variability inherent in predicting protein functions, necessitating more sophisticated approaches. In this work, we introduce Protein-Mamba, a novel two-stage model that leverages both self-supervised learning and fine-tuning to improve protein function prediction. The pre-training stage allows the model to capture general chemical structures and relationships from large, unlabeled datasets, while the fine-tuning stage refines these insights using specific labeled datasets, resulting in superior prediction performance. Our extensive experiments demonstrate that Protein-Mamba achieves competitive performance, compared with a couple of state-of-the-art methods across a range of protein function datasets. This model’s ability to effectively utilize both unlabeled and labeled data highlights the potential of self-supervised learning in advancing protein function prediction and offers a promising direction for future research in drug discovery.

1 Introduction

Predicting protein function is a fundamental challenge in molecular biology, with profound implications for drug discovery and development. Accurately predicting how proteins function can significantly enhance the efficiency of drug discovery by identifying viable drug candidates earlier in the development process, thus reducing time and costs associated with experimental validation [24]. Traditional machine learning models, while useful, often struggle with the complexities and diverse nature of protein data, necessitating the development of more sophisticated approaches.

In recent years, machine learning models have become increasingly important in predicting protein function, offering a way to prioritize potentially desirable proteins without the need for extensive and resource-intensive wet-lab experiments [12, 11]. This approach can significantly accelerate the drug discovery process, saving time and resources while improving the chances of identifying viable drug candidates. However, traditional models often struggle with the complexity and variability inherent in protein function prediction, necessitating the development of more sophisticated approaches.

This paper introduces Protein-Mamba, a two-stage model designed to enhance protein function prediction by leveraging both unlabeled and labeled data through self-supervised learning-based pretraining followed by fine-tuning. By learning from a vast corpus of unlabeled amino acid sequences, during the pretraining stage, Protein-Mamba captures underlying chemical structures and relationships, which are then fine-tuned on downstream tasks using labeled datasets. Our results demonstrate that Protein-Mamba outperforms several state-of-the-art methods across a range of protein function datasets, highlighting the potential of self-supervised learning in advancing protein function prediction and providing a promising direction for future research in drug discovery.

Our contributions of this paper could be summarized as:

• We introduce Protein-Mamba, a two-stage model that combines pre-training and fine-tuning to leverage both unlabeled and labeled data for protein function prediction.

• Protein-Mamba demonstrates competitive performance when compared to a range of state-of-the-art methods across several protein function datasets.

2 Background

2.1 Protein

Proteins are the building blocks of life. Every cell in the human body contains proteins. Proteins carry out all the essential functions in the human body. Proteins support almost all biological activities. For example, stomach enzymes serve to digest food; the movement of myosin on actin is the driving force for muscular contraction; whey proteins strengthen cell anti-oxidation; and antibodies protect us from disease.

Table 1: All the 20 natural amino acids, and their abbreviations and frequencies. The frequencies are evaluated on all the processed protein data in the RCSB Protein Data Bank (RCSB PDB) (https://www.rcsb.org/).

class	abbreviation	percentage (%)
Glycine	Gly / G	7.6%
Alanine	Ala / A	7.7%
Valine	Val / V	7.0%
Leucine	Leu / L	8.6%
Isoleucine	Ile / I	5.5%
Proline	Pro / P	4.6%
Phenylalanine	Phe / F	3.6%
Tyrosine	Tyr / Y	3.1%
Tryptophan	Trp / W	1.2%
Serine	Ser / S	6.7%
Threonine	Thr / T	5.7%
Cystine	Cys / C	1.3%
Methionine	Met / M	2.7%
Asparagine	Asn / N	4.1%
Glutamine	Gln / Q	3.9%
Aspartic acid	Asp / D	5.3%
Glutamic acid	Glu / E	6.5%
Lysine	Lys / K	6.3%
Arginine	Arg / R	5.3%
Histidine	His / H	3.1%

Amino acid. A protein is an amino acid sequence folded into a three-dimensional structure. As illustrated in Figure 1, amino acids are small organic molecules that consist of an $\alpha$ (central) carbon atom linked to an amino group (denoted $C_{\alpha}$ in Figure 1), a carboxyl group (-COOH, C is $C_{\beta}$ in Figure 1), a hydrogen atom (H), and a variable component called a side chain (denoted “R” in Figure 1). The nitrogen (N), alpha carbon ($C_{\alpha}$), and carboxyl carbon ($C_{\beta}$) are in common for all the amino acids and compose the protein backbone. The protein backbone holds a protein together and gives it an overall shape. The side chain determines the category of amino acids. Different amino acids differ in the side chain (R), also referred to as an amino acid residue. Multiple amino acids are linked together within a protein by peptide bonds, thereby forming a long chain. Amino acids are the basic building blocks of a protein/antibody. There are 20 natural amino acids, including Alanine (abbreviated Ala or A), Cysteine (Cys, or C), Glutamine (Gln, or Q), Glycine (Gly, or G), Valine (Val, or V), Leucine (Leu, or L), etc. The list of all the 20 natural amino acids, their abbreviations, and frequencies is provided in Table 1.

Figure 1: Structure of amino acid. Amino acids are small organic molecules, where the central carbon atom (denoted $C_{\alpha}$ or alpha-carbon) connects to a carboxyl group (-COOH, C is $C_{\beta}$ or beta-carbon), a hydrogen atom (H), and a variable component called a side chain (denoted residue “R”). The side chain (or amino acid residue) determines the category of amino acids. There are 20 kinds of side chains, which means there are 20 kinds of amino acids.

Table 2: Examples of amino acid sequences. A single letter represents one amino acid. The length of an amino acid sequence is typically several hundred, so we only show a part of the entire amino acid sequence. “1IEP” is the kinase domain of c-Abl; “3NY8” is the human beta2 adrenergic receptor; “3PBL” is the human dopamine D3 receptor.

protein ID	amino acid sequence
1IEP	GAMDPSSPNYDKWEMERTDITMKHKLGGGQY…
3NY8	DYKDDDDAMGQPGNGSAFLLAPNRSHAPDHD…
3PBL	DYKDDDDGAPASLSQLSSHLNYTCGAENSTG…

A protein is usually represented by four levels of hierarchical structures: (1) primary structure (i.e., amino acid sequence), (2) secondary structure, (3) tertiary structure, and (4) quaternary structure. They characterize the hierarchical structure of a protein at different levels of complexity, as described below.

1. Primary structure. The primary structure of a protein is simply the sequence of amino acids in a polypeptide chain. We show some examples of amino acid sequences in Table 2.

2. Secondary structure. The secondary structure of a protein refers to regular, recurring arrangements in the space of adjacent amino acid residues in a polypeptide chain. It characterizes the localized conformation of the polypeptide chain. There are a total of 8 categories of secondary structures, e.g., $\alpha$-helix, Turn, Bend, $\pi$-helix, 3-10 helix, Strand, Isolated beta-bridge residue, and None (also called coil, which is not in any above formations) [18]. Each amino acid belongs to one of these 8 secondary structures.

3. Tertiary structure. The tertiary structure of a protein refers to the overall three-dimensional arrangement of its polypeptide chain in Euclidean space.

4. Quaternary structure. The quaternary structure of a protein describes the relationship of multiple polypeptide chains (or subunits) into a closely packed arrangement. Each polypeptide chain has its own primary, secondary, and tertiary structure. The proteins with a single polypeptide chain do not have quaternary structures.

2.2 Protein Function Prediction

Protein function prediction is essential in macromolecule drug design because it provides valuable insights into proteins’ biological roles and behavior. Several key properties of macromolecular drugs impact their qualification as effective pharmaceuticals.

• Biological activity: Macromolecular drugs must possess the ability to exert the desired effects on target biomolecules or biological processes. They should interact specifically with particular receptors, enzymes, or other biomolecules to modify or regulate their function. The biological activity of a drug directly affects its therapeutic efficacy.

• Specificity: Macromolecular drugs should exhibit high specificity, meaning they bind selectively to the target molecule or receptor without interacting with non-target molecules. This helps reduce unnecessary side effects and toxicity, enhancing the drug’s safety profile.

• Stability: Macromolecular drugs must exhibit sufficient stability within the body to maintain their structural and functional integrity. They should withstand degradation or inactivation under physiological conditions. Stability is crucial for the drug’s longevity and therapeutic effectiveness.

• Pharmacokinetic properties: Macromolecular drugs should possess appropriate pharmacokinetic properties in the body, including absorption, distribution, metabolism, and excretion. These properties influence the drug’s bioavailability, duration of action, and tissue or organ distribution.

• Immunogenicity: Macromolecular drugs should have low immunogenicity, meaning they elicit minimal immune responses within the body. Immune reactions can lead to drug ineffectiveness, allergic reactions, or immune-related adverse events. Thus, minimizing immunogenicity is an important consideration in the design and development of macromolecular drugs.

Understanding a protein’s function helps identify potential drug candidates and design drugs that can interact with the protein in a desired manner. For example, the developability of the protein is determined by several factors. Immunogenicity, instability, self-association, high viscosity, poly-specificity, or poor expression can all preclude an antibody from becoming therapeutic. If machine learning models could accurately identify these negative characteristics in the early drug discovery process, many high-risk wet lab experiments could be avoided, saving time and money.

Also, for ease of understanding and quick check, Table 3 summarizes most of the important terminologies used in this paper and their descriptions.

Table 3: Glossary of terms used in this paper.

Term	Description
Amino acids	Amino acids are building blocks for proteins, which come in 20 different kinds. They can combine to form proteins.
Backbone (protein)	Protein backbone is a continuous chain of a repeated sequence of nitrogen, alpha carbon, and beta carbon, which gives the protein’s overall shape.
Protein function	Protein function refers to the specific role or purpose that a protein serves in a biological system. Proteins have diverse functions, ranging from stability, thermostability, solubility, and biological activity, among many others. The function of a protein is determined by its unique sequence of amino acids, which influences its three-dimensional structure and interactions with other molecules. Understanding protein function is essential for macromolecule drug discovery.
Solubility	Protein solubility is the capacity of a protein to dissolve and remain in solution, playing a crucial role in governing the protein’s behavior and functionality across diverse biological and industrial contexts.
Stability	Protein stability encompasses the capacity of a protein to preserve its three-dimensional structure and functional attributes across diverse environmental conditions, playing a fundamental role in ensuring optimal protein functionality and longevity within biological systems.
Thermostability	Thermostability of a protein refers to its capability to preserve its structural integrity and functional activity even under elevated temperatures. The thermostability of a protein is a critical characteristic that can impact its suitability as a drug candidate.

Then, we formulate the protein function prediction problem.

Problem 1 (Protein function prediction).

The goal is to predict the protein function $y$ given the protein structure information, typically amino acid sequence. Formally, it is defined as

$$y=f_{\bf{\theta}}(\bf{S}),$$ (1)

where $y$ is the label of the problem, which can be either a categorical variable or a continuous value. $f_{\bf{\theta}}$ denotes the machine learning model parameterized by $\bf{\theta}$. $\bf{S}=(\bf{s}_{1},\cdots,\bf{s}_{N})$ denotes the amino acid sequence, consisting of $N$ amino acids.

Table 4: Statistics of protein function prediction datasets. Following the original paper [27], the training/validation/test splits are carefully designed to make sure all the proteins in the test set are significantly different from the training and validation sets so that we can evaluate the generalization ability of deep learning techniques in real-world settings [27]. “Seq. Len.” represents the average amino acid sequence length and the standard deviation.

Function	Dataset	Seq. Len.	# train/valid/test	Task
GB1 fitness	FLIP	378.6(0.9)	381/43/8,309	regression
AAV fitness	FLIP	1033.0(3.4)	28,626/3,181/50,776	regression
Thermostability	FLIP	880.6(974.2)	5,149/643/1,366	regression
Fluorescence	Sarkisyan	343.3(1.3)	21,446/5,362/27,217	regression
Stability	Rocklin	66.6(5.2)	53,571/2,512/12,851	regression
$\beta$-lactamase activity	Envision	396.1(0.7)	4,158/520/520	regression
Solubility	DeepSol	424.1(225.9)	62,478/6,942/1,999	classification

2.3 Data

We use machine learning approaches to predict several protein functions, as shown in the following.

• Solubility. Protein solubility refers to the ability of a protein to dissolve or remain in a solution. It is an essential property that determines the protein’s behavior and functionality in various biological and industrial applications. The solubility of a protein is influenced by several factors, including its amino acid composition, ionic strength, pH, temperature, and the presence of other molecules in the solution. We incorporate the DeepSol dataset for protein solubility prediction.

  • DeepSol [13]. DeepSol comprises 71,419 proteins with binary labels. The training, validation, and test splits used in our study follow [13], wherein protein sequences exhibiting a sequence identity of 30% or higher with any sequence in the test set are excluded from the training set. This split assesses the model’s capacity to generalize across dissimilar protein sequences. The training, validation, and test set contains 62478, 6942, and 1999 proteins, respectively.

• Thermostability. The thermostability of a protein refers to its ability to maintain its structural integrity and functional activity at high temperatures. Proteins are composed of intricate three-dimensional structures that are essential for their biological function. However, when exposed to elevated temperatures, proteins can undergo denaturation, which involves the disruption and unfolding of their native structure. This denaturation can lead to the loss of protein function. Thus, protein thermostability is an important characteristic that can influence the potential of a protein to become a drug. We incorporate the FLIP-thermostability dataset for thermostability prediction.

  • FLIP-thermostability. The data source is from the FLIP benchmark [5]. The groundtruth (temperature) is a continuous value. The training/validation/test sets consist of 5149, 643, and 1366 data samples, respectively.

• GB1 fitness. GB1 fitness assesses the fitness values of potential mutants of the GB1 protein [25]. This study focuses on the protein G, an immunoglobulin-binding protein, which utilizes the GB1 binding domain to carry out its function. The objective of this investigation is to examine the effects of interactions between mutations and explore ways to enhance the fitness of this crucial functional protein through engineering.

  • FLIP-GB1. The data source is from the FLIP benchmark [5]. The groundtruth is the fitness value, a continuous value. The training, validation, and test sets contain 381, 43, and 8309 data points, respectively.

• AAV fitness. The manipulation of Adeno-associated virus (AAV) capsid proteins holds significant promise for gene therapy, as it enables the virus to deliver a DNA payload into a specific target cell efficiently. This has garnered considerable interest in the field of gene therapy. AAV fitness evaluates the fitness scores of mutants of VP-1 AAV proteins.

  • FLIP-AAV. The data source is from the FLIP benchmark [5]. The groundtruth (fitness score) is a continuous value. The training, validation, and test sets contain 28,626/3,181/50,776 data points, respectively.

• Fluorescence (Flu). Protein fluorescence refers to the phenomenon where certain proteins can emit light of a specific wavelength when excited by light of a shorter wavelength. It is a widely used technique to study protein structure, dynamics, interactions, and function. Proteins that exhibit fluorescence typically contain intrinsic fluorophores, such as tryptophan, tyrosine, and phenylalanine residues, which absorb photons and undergo electronic transitions, leading to fluorescent light emission. The emitted fluorescence can be measured and analyzed to provide insights into various aspects of protein behavior, such as folding, conformational changes, binding to other molecules, and enzymatic activity. Protein fluorescence techniques, including fluorescence spectroscopy, fluorescence microscopy, and fluorescence-based assays, offer sensitive and non-invasive tools for studying proteins in vitro and in vivo. They have wide applications in macromolecule drug discovery.

  • Sarkisyan [20]. The label is the logarithm of fluorescence intensity. The training and validation sets comprise mutants containing three or fewer mutations, while the test set comprises mutants with four or more mutations. The training, validation, and test sets contain 21446, 5362, and 27217 proteins, respectively.

• $\beta$-lactamase activity. This task focuses on investigating the enhancement of activity for $\beta$-lactamase, the most prevalent enzyme responsible for conferring beta-lactam antibiotic resistance to gram-negative bacteria through single mutations.

  • Envision [8]. The groundtruth represents the experimentally tested fitness score, which quantifies the scaled mutation effect for each mutant. The training, validation, and test sets contain 4158, 520, and 520 proteins, respectively.

• Stability (Sta). Protein stability refers to the ability of a protein to maintain its three-dimensional structure and functional properties under various environmental conditions. It is crucial for the proper functioning and longevity of proteins in biological systems. The stability of a protein is determined by its ability to resist denaturation, aggregation, and degradation.

  • Rocklin dataset was collected by [19] to measure protein stability experimentally. The proteins obtained from four rounds of experimental design are utilized for training and validation purposes. Then, the top candidates containing single mutations are employed for testing. This evaluation assesses the model’s generalization ability, as it is trained on data with multiple mutations and then applied to identify the top candidates with single mutations. The training, validation, and test sets contain 53,571, 2,512, and 12,851 proteins.

The statistics of all the datasets are described in Table 4.

3 Method: Protein-Mamba

3.1 Overview

The Protein-Mamba model utilizes a two-stage approach involving pre-training and fine-tuning to improve protein function prediction by efficiently leveraging both unlabeled and labeled data. We first describe the basic Mamba model in Section 3.2. The pretraining and finetuning steps are described in Section 3.3 and Section 3.4, respectively.

3.2 Model Backbone: Mamba

Mamba [9] is a version of the Structured State Space Sequence (S4) model that is specifically designed to handle long-term patterns in sequential data. Unlike traditional models, Mamba is particularly good at tasks like time-series analysis and natural language processing because it can capture both short-term and long-term patterns within sequences. It uses state space models to keep track of and update hidden states over long sequences, which helps in accurately modeling complex time-based data. Mamba’s design also allows for efficient parallel processing, making it scalable for large datasets. This makes it especially useful in areas where understanding long-term dependencies is important. Mamba has been successfully applied in various fields, including natural language processing [22, 32], computer vision [29, 23], EEG analysis [28], and drug discovery [26].

Transformers [21] and Mamba are both powerful models for handling sequential data, but they employ different approaches and dominate in distinct areas. Transformers utilize self-attention mechanisms to capture dependencies within sequences, making them particularly effective for tasks like natural language processing and machine translation, where they can model relationships between all sequence elements simultaneously. However, they can face challenges with very long sequences due to their high computational complexity. On the other hand, Mamba, which is built on the Structured State Space Sequence (S4) model, is optimized for efficiently managing long-range dependencies by using state space models that maintain and update hidden states over extended sequences. This design makes Mamba especially suitable for tasks like time-series analysis, where capturing long-term temporal patterns is essential. While Transformers offer versatility and robust performance across a wide range of tasks, Mamba is experienced at handling long sequences and long-range dependencies.

3.3 Pretraining on Large Unlabelled Data

Pretraining is crucial as it enables a model to learn general features and patterns from large datasets, which can later be fine-tuned for specific downstream tasks using smaller labeled datasets. This approach greatly enhances the model’s performance, reduces the need for extensive labeled data, and speeds up training for downstream tasks by beginning with a well-initialized model rather than starting from scratch.

During the pre-training stage, the model is trained on a large corpus of unlabeled protein data, such as amino acid sequences, to learn the underlying biological structures and relationships. This stage enables the model to develop a comprehensive representation of protein features without relying on explicit labels, capturing crucial patterns and dependencies within the data. The Mamba model, which is autoregressive, uses next-step prediction as its pretraining objective. Since the dataset lacks any labels related to protein function, the pretrained Mamba model remains function-agnostic.

RCSB. We use protein amino acid sequence for pretraining. Specifically, we download all the protein data in pdb format from https://www.rcsb.org/. The Protein Data Bank (PDB) file format is a textual format used to describe the three-dimensional structures of molecules stored in the Protein Data Bank. This format includes detailed descriptions and annotations of protein and nucleic acid structures, such as atomic coordinates, secondary structure assignments, and atomic connectivity. A comprehensive list of all amino acids, their secondary structures, and their frequencies is available in the supplementary materials. Our dataset includes 27,043 proteins, each with a single chain. We use it to pretrain a function-agnostic Mamba model.

3.4 Fine-tuning on Downstream Tasks

After pre-training, the model is fine-tuned using a smaller, labeled dataset tailored to the target task, such as predicting protein functions like solubility, stability, and thermostability. Fine-tuning involves adjusting the pre-trained model’s parameters to optimize its performance on the specific task, leveraging the labeled data to refine and improve its predictions. This two-stage process greatly enhances the model’s ability to predict protein functions by combining the broad generalization capabilities acquired during pre-training with the task-specific insights obtained through fine-tuning.

By leveraging both unlabeled and labeled data, the Protein-Mamba model delivers superior prediction performance, establishing itself as a powerful tool in drug discovery and other applications that demand precise protein function prediction. This approach reduces the dependence on large quantities of labeled data, which are often scarce and expensive to acquire.

4 Experiment

In this section, we provide a detailed overview of the empirical studies, covering baseline methods, evaluation metrics, implementation details, experimental results, and their subsequent analysis.

4.1 Experimental Setup

Evaluation Metrics.

Protein function prediction can be categorized into two machine learning tasks (classification and regression) based on the groundtruth. For classification tasks (mostly binary classification), we use accuracy as metric. On the other hand, for regression tasks, we select Spearman as the evaluation metric: Spearman’s rank correlation coefficient (Spearman) is the Pearson correlation coefficient between the rank variables. Higher values indicate better performance. It is used when a trend (ranking) is more important than the absolute error.

Baseline Methods.

The key challenge of protein function prediction is to obtain a powerful representation of the protein amino acid sequence. We cover various neural network architectures, as shown in the following.

1. One-dimensional Convolutional neural network (1D-CNN). 1D-CNN takes amino acid sequences as the input. 1D-CNN has four layers; the number of filters for the four layers is 32, 64, 96, and 128, respectively. The kernel sizes are 6, 8, 10, and 12, respectively. The convolutional layer is followed by a one-layer MLP to produce the prediction, which is a scalar.

2. Long short-term memory (LSTM). We use the bidirectional three-layer LSTM to represent the amino acid sequence. Bidirectional LSTM scans the amino acid sequences based on forward and reverse order. The hidden variables of the last hidden state from both forward and reverse order are concatenated as the output of bidirectional LSTM, which is followed by a two-layer MLP and makes the prediction. In LSTM, the dimension of the hidden state is set to 100.

3. Transformer. We use the transformer encoder [21] to represent the amino acid sequence. Three layers of transformer architectures are stacked. The dimension of embedding in the transformer is set to 100. The number of attention heads is set to 8.

4. ResNet+1D-CNN (ResNet). ResNet+1D-CNN utilizes the residual network [10] to enhance 1D-CNN to alleviate the gradient vanishment issue. Specifically, the residual network skips some hidden-layer connections and jumps over some hidden layers in CNN. The other setup is the same as the 1D-CNN mentioned above.

5. Protein BERT (ProtBERT) [1]. Bidirectional Encoder Representations from Transformers (BERT) is a transformer-based neural network architecture pretrained on unlabeled sequence data. Here, BERT [6] is pretrained on a large number of unlabeled amino acid sequences and then finetunes on labeled training datasets. The sizes of the token and positional embeddings are both 1024. It stacks 30 transformer blocks, and the number of attention heads is 16.

Table 5: Experimental results of protein function prediction on various datasets. On each task, we highlight the best method. For all the tasks, higher values indicate better performance (denoted $\uparrow$).

Method	GB1	AAV	Thermo	Flu	Stab	$\beta$-lac	Solubi
Metric	Spearman ($\uparrow$)	Spearman ($\uparrow$)	Spearman ($\uparrow$)	Spearman ($\uparrow$)	Spearman ($\uparrow$)	Spearman ($\uparrow$)	accuracy (%) ($\uparrow$)
LSTM	-0.002(0.003)	0.125(0.025)	0.564(0.007)	0.494(0.071)	0.533(0.101)	0.139(0.051)	70.18(0.63)
Transformer	0.271(0.020)	0.681(0.013)	0.545(0.031)	0.643(0.005)	0.649(0.056)	0.261(0.015)	70.12(0.31)
CNN	0.502(0.007)	0.746(0.003)	0.494(0.021)	0.682(0.002)	0.637(0.010)	0.781(0.011)	64.43(0.25)
ResNet	0.133(0.095)	0.739(0.013)	0.528(0.009)	0.636(0.021)	0.126(0.094)	0.152(0.029)	67.33(1.46)
ProtBERT	0.634(0.047)	0.794(0.014)	0.660(0.009)	0.679(0.001)	0.771(0.020)	0.731(0.226)	68.15(0.92)
Protein-Mamba	0.706(0.013)	0.754(0.008)	0.674(0.002)	0.683(0.002)	0.753(0.010)	0.788(0.009)	68.25(0.40)

Implementation Details.

All the experiments are conducted on an NVIDIA GeForce RTX 3090 GPU. Protein-Mambais implemented in Python 3.8 and PyTorch 1.9.0. The Adam [14] is used as numerical optimizer with initial learning rate 1e-3. In pretraining phase, the maximal epoch number is set to 100. In finetuning process, the maximal epoch number is set to 50. We use early stop strategy to save the training time and computational resources and avoid overfitting. The Protein-Mamba architecture consists of 8 layers, the hidden state dimension is set to 300, while the number of attention heads is set to 8.

4.2 Results & analysis.

The results for absorption, distribution, metabolism, excretion, and toxicity property prediction are reported in Table 5. By carefully comparing all the results, we draw a couple of conclusions as follows:

• First, the proposed Protein-Mamba model exhibits competitive performance in all the protein function tasks. Concretely, compared with five cutting-edge machine learning models, it achieves the highest score in four tasks and top-2 performance in six tasks among all seven various protein function prediction tasks.

• Secondly, self-supervised learning-based pretraining strategies have shown to be highly effective. Models such as the proposed Protein-Mamba and ProtBERT [1] stand out by utilizing self-supervised learning to derive valuable insights from unlabeled data. These approaches underscore the potential of self-supervised learning as a promising avenue for future research, highlighting its substantial impact on improving model performance in protein function prediction.

• Third, no single method performs best across all tasks, as results can differ based on the type of features and the specific task. This difference comes from the unique information captured by various protein representations and machine learning models. Therefore, combining these different feature types could lead to even better model performance.

5 Conclusion

In this paper, we presented Protein-Mamba, a novel two-stage model for protein function prediction that leverages both unlabeled and labeled data. By integrating self-supervised pretraining with fine-tuning, Protein-Mamba effectively captures the intricate relationships within protein data. Our extensive experiments demonstrated that Protein-Mamba outperforms several state-of-the-art models across a variety of protein function prediction tasks, underscoring the effectiveness of self-supervised learning in this domain. By reducing the dependency on large labeled datasets, Protein-Mamba not only improves prediction accuracy but also opens new avenues for research in drug discovery, potentially accelerating the identification and development of safe and effective drug candidates. The success of Protein-Mamba highlights the critical role of advanced machine learning techniques in tackling the complex challenges inherent in drug discovery and development.

Future research can be pursued in the following three areas: (1) In early-stage clinical trials, precise protein function profiling is crucial as it helps researchers understand how a drug is absorbed, distributed, metabolized by enzymes, excreted, and whether it poses any toxic risks. This detailed information enables the identification of potential safety concerns before large-scale trials, thereby preventing costly failures at later stages [30, 31, 15, 4]; (2) Integration of protein function data with multi-omics: Combining protein function data with genetic, transcriptomic, and metabolic information allows researchers to gain deeper insights into how these variations influence drug behavior and response across different individuals or populations [2, 16, 17, 3]. This integration facilitates the identification of biomarkers for predicting drug efficacy and toxicity, supports the development of more effective and personalized therapies, and helps minimize adverse drug reactions [7, 33].