University of California Berkeley] Department of Chemical and Biomolecular Engineering, University of California Berkeley, Berkeley, California 94720, USA University of California Berkeley] Department of Chemical and Biomolecular Engineering, University of California Berkeley, Berkeley, California 94720, USA University of California Berkeley] Department of Chemical and Biomolecular Engineering, University of California Berkeley, Berkeley, California 94720, USA University of California Berkeley] Department of Chemical and Biomolecular Engineering, University of California Berkeley, Berkeley, California 94720, USA \alsoaffiliation[University of California Berkeley] Department of Bioengineering, University of California, Berkeley, CA 94720, USA University of California Berkeley] Department of Chemical and Biomolecular Engineering, University of California Berkeley, Berkeley, California 94720, USA \alsoaffiliation[Lawrence Berkeley National Lab] Materials Sciences Division, Lawrence Berkeley National Lab, Berkeley, California 94720, USA

Effects of Ionic Strength on the Morphology, Scattering, and Mechanical Response of Neurofilament-derived Protein Brushes

Takashi J. Yokokura [    Chao Duan [    Erika A. Ding [    Sanjay Kumar [    Rui Wang ruiwang325@berkeley.edu [
Abstract

Protein brushes not only play a key role in the functionality of neurofilaments but also have wide applications in biomedical materials. Here, we investigate the effect of ionic strength on the morphology of protein brushes using a continuous-space self-consistent field theory. A coarse-grained multi-block charged macromolecular model is developed to capture the chemical identity of amino acid sequences. For neurofilament heavy (NFH) brushes at pH 2.4, we predict three morphological regimes: swollen brushes, condensed brushes, and coexisting brushes which consist of both a dense inner layer and a diffuse outer layer. The brush height predicted by our theory is in good agreement with experimental data for a wide range of ionic strengths. The dramatic height decrease is a result of the electrostatic screening-induced transition from the overlapping state to the isolated state of the coexisting brushes. We also study the evolution of the scattering and mechanical responses accompanying the morphological change. The oscillation in the reflectivity spectra characterizes the existence and microstructure of the inner condensed layer, whereas the shoulder in the force spectra signifies the swollen morphology. {tocentry} [Uncaptioned image]

keywords:
self-consistent field theory, protein brush, neurofilament heavy, reflectivity, force spectroscopy

1 Introduction

Neurofilaments (NFs) are cylindrical, self-assembled protein filaments organized axially within the axon. Brushes consisting of intrinsically disordered proteins (IDPs) protrude out from the NF cores, which play a critical role in the stability, organization, and functionality of the neuron 1, 2. Mutations in the comprising proteins have also been linked to neurodegenerative diseases such as amyotrophic lateral sclerosis, Alzheimer’s disease, and Parkinson’s disease, in which the instability of the NFs may contribute to neuronal cell death 3, 4, 5. Furthermore, protein-inspired brushes arouse great interest in practical applications because of their unique properties in biocompatibility 6, 7, sensitivity to external stimuli 8, 9, and ease of genetic modification 10. These advantages enable their wide application in biomedical devices and materials, such as sensors 11, 12, 13, valves 14, 15, actuators 16, 17, artificial cartilage 18, and vehicles for drug/gene delivery 19.

Understanding the morphology and interactions of protein and protein-inspired brushes remains a great challenge. In an earlier work, the Kumar group modified the tail domain of neurofilament heavy (NFH), which is a major component of neurofilaments, and further grafted the recombinant protein to a planar surface 20. They observed a dramatic height change in response to the addition of monovalent salt at a critical ionic strength: the height reduces by a factor of three within a narrow salt concentration range of 2 mM. This height reduction is far steeper than the 1/313-1/3- 1 / 3 scaling predicted by existing theories for homogeneous polyelectrolyte brushes 21, 22. The height was also found to be sensitive to pH. Additionally, there is debate on the role of NFH in structurally stabilizing the axon. Whether this stability is attributed to steric effects as a result of cross-links between neighboring NFHs or induced by electrostatic repulsion is not clear 23, 24. There is additional controversy on whether NFH plays a role in setting the axonal diameter based on transgenic mouse studies 25, 26, 27. Besides external stimuli, protein brush morphology also depends on the intrinsic chemical properties encoded by the amino acid sequence of the comprising proteins. By replacing serine with more charged aspartate residues, the Kumar group found that the backbone charge density of the protein has a significant effect on the height of NFH-inspired brushes28. They also found that brush height is heavily influenced by protein phosphorylation 29. Similar morphological behaviors have also been observed in synthetic polyelectrolyte brushes 30, 22.

Great efforts have been made to theoretically study the morphological behaviors of protein-inspired brushes using polymer brush models. While the pioneering scaling theory can predict macroscopic information such as brush height, it is unable to describe the density distribution of the constituent monomers 31, 32. Furthermore, the so-called “classical” or “strong stretching theory” is restricted to highly stretched chains due to the classical path approximation 33, 34, 35. It fails to capture brushes with other chain conformations and cannot explicitly account for the amino acid sequence. Recently, lattice self-consistent field theory (commonly known as the Scheutsjen-Fleer model) 36, 37, 38, 39, has been widely applied to describe synthetic and protein-inspired brushes. Using this method, Zhulina and Leermakers predict the morphological response of NFs to ionic strength and pH 40, 41. However, the experimentally observed dramatic height change of NFH brushes with the addition of salt at low pH has not been investigated by the lattice self-consistent field theory 20.

\phantomsubcaption
\phantomsubcaption
\phantomsubcaption
Refer to caption
Figure 1: (a) Schematic of IDP brush immersed in salt solution. Colorbar illustrates the charge of different species. (b) Schematic of the coarse-graining approach to represent an IDP with a particular amino acid sequence by the multi-block charged macromolecular model. Each block Bisubscript𝐵𝑖B_{i}italic_B start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT is parameterized by its backbone charge density αisubscript𝛼𝑖\alpha_{i}italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT, hydrophobicity χisubscript𝜒𝑖\chi_{i}italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT, and equivalent number of Kuhn segments Nisubscript𝑁𝑖N_{i}italic_N start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT. (c) Application of the coarse-graining procedure to NFH at pH 2.4. The charge of each amino acid residue, cumulative sum (cusum), and block charge distribution are plotted against the residue number.

Characterizing the microstructure of protein brushes is critical to understanding their morphological response, surface activity, and functionality. However, the overall height as obtained from spectroscopic ellipsometry or atomic force microscopy (AFM) measurements cannot directly provide the detailed distribution of amino acids in the brush. In this work, we apply a continuous-space self-consistent field theory (SCFT) to elucidate the relationship between the chemical structure and morphological behavior of protein brushes. A coarse-graining approach built upon a multi-block charged macromolecular model is developed to capture the chemical identity of the amino acid sequence. We investigate the morphological response of NFH brushes to ionic strength. The theoretical prediction shows good agreement with the experimental results reported in the literature 20. The evolution of scattering spectra and mechanical properties accompanying the morphological changes is also examined. We show the effectiveness of reflectivity and force spectroscopy in detecting the microstructure of protein brushes.

2 Model and Theory

We consider a system consisting of intrinsically disordered proteins (IDPs) grafted on a planar surface as shown in Fig. 1. The system is treated as a semi-grand canonical ensemble: the number of proteins is fixed, whereas solvent and mobile ions are connected with a bulk salt solution of ion concentration c±bsuperscriptsubscript𝑐plus-or-minus𝑏c_{\pm}^{b}italic_c start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_b end_POSTSUPERSCRIPT to maintain the chemical potentials of solvent μssubscript𝜇𝑠\mu_{s}italic_μ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT and ions μ±subscript𝜇plus-or-minus\mu_{\pm}italic_μ start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT. Mobile ions are taken as point charges with valency z±subscript𝑧plus-or-minusz_{\pm}italic_z start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT. The widely adopted multi-block charged macromolecular model 41, 42, 43 is used to represent IDPs. The charged macromolecules are assumed to be Gaussian chains of N𝑁Nitalic_N total segments with Kuhn length b𝑏bitalic_b. This is also a general model for synthetic polyelectrolytes and other biomacromolecules 44, 42.

We develop a coarse-graining approach to map the chemical identity of any amino acid sequence to the multi-block charged macromolecule. Adjacent amino acids with similar charge and hydrophobicity are grouped into a block as illustrated in Fig. 1. Each block is thus a section of homopolymer with number of residues Nisuperscriptsubscript𝑁𝑖N_{i}^{*}italic_N start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT start_POSTSUPERSCRIPT ∗ end_POSTSUPERSCRIPT, smeared backbone charge density αisubscript𝛼𝑖\alpha_{i}italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT, and hydrophobicity χisubscript𝜒𝑖\chi_{i}italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT (manifested in terms of the Flory-Huggins parameter accounting for the short-range van der Waals interactions between amino acids and solvent). The equivalent number of Kuhn segments in this block is Ni=NilA/bsubscript𝑁𝑖superscriptsubscript𝑁𝑖subscript𝑙𝐴𝑏N_{i}=N_{i}^{*}l_{A}/bitalic_N start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT = italic_N start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT start_POSTSUPERSCRIPT ∗ end_POSTSUPERSCRIPT italic_l start_POSTSUBSCRIPT italic_A end_POSTSUBSCRIPT / italic_b, where lA=0.36subscript𝑙𝐴0.36l_{A}=0.36italic_l start_POSTSUBSCRIPT italic_A end_POSTSUBSCRIPT = 0.36 nm is the average contour length of an amino acid 45, 46. In this work, the grouping procedure is simplified by only considering the charge distribution along the amino acid sequence. Each amino acid is treated as a weak acid/base, where its charge is calculated from the dissociation constant (pKasubscriptpKa\mathrm{pK_{a}}roman_pK start_POSTSUBSCRIPT roman_a end_POSTSUBSCRIPT/pKbsubscriptpKb\mathrm{pK_{b}}roman_pK start_POSTSUBSCRIPT roman_b end_POSTSUBSCRIPT) of its residue and the bulk pH through the Henderson-Hasselbalch equation 47. An alternative but more rigorous treatment can be achieved by explicitly considering the effect of local proton concentration on the dissociation equilibrium (See Sec. II.2 of the SI for the annealed model for protein charge). The blocks are determined by tracking the cumulative sum (cusum) of the charge distribution along the amino acid sequence. The section of Nisuperscriptsubscript𝑁𝑖N_{i}^{*}italic_N start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT start_POSTSUPERSCRIPT ∗ end_POSTSUPERSCRIPT amino acids which contributes to a nearly constant slope in the cusum is grouped as a block. The charge density of this block αisubscript𝛼𝑖\alpha_{i}italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT is directly identified by the slope.

Fig. 1 illustrates the coarse-graining procedure for NFH at pH 2.4, from the initial charge of each amino acid residue to the cusum and finally to the length and charge of each block. Because amino acids are chemically similar, we assume that the hydrophobic interactions between different blocks are negligible. To determine the block hydrophobicity χisubscript𝜒𝑖\chi_{i}italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT, residues are categorized into apolar, polar, and charged groups as used in previous work 40. Each group is assigned a corresponding Flory-Huggins parameter based on the values reported in the literature 40. The hydrophobicity χisubscript𝜒𝑖\chi_{i}italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT of each block is then the average of its constituent amino acid Flory-Huggins parameters. The resulting sets of αisubscript𝛼𝑖\alpha_{i}italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT and χisubscript𝜒𝑖\chi_{i}italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT for NFH are presented in Table 1. The details of the NFH sequence are provided in Sec. I of the SI. The numerical results obtained by the theory are found not to be sensitive to the fineness of the coarse-graining model as long as the number of blocks is large enough (see the sensitivity analysis in Sec. III of the SI).

Table 1: Partitions of amino acid residues, charge density αisubscript𝛼𝑖\alpha_{i}italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT, and hydrophobicity χisubscript𝜒𝑖\chi_{i}italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT of coarse-grained blocks for NFH at pH 2.4 in the multi-block charged macromolecular model.
Block Residues αisubscript𝛼𝑖\alpha_{i}italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT χisubscript𝜒𝑖\chi_{i}italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT
1 [1,   28] 0.204967 1.586207
2 [29,  87] 0.027801 1.434483
3 [88,  319] 0.170493 2.113793
4 [320, 609] 0.261110 1.534483
5 [610, 647] 0.336030 0.989474

The semi-grand canonical partition function can be written as:

Ξ=Ξabsent\displaystyle\Xi=~{}roman_Ξ = 1np!νNnpγnγ=0eμγnγnγ!vγnγ1subscript𝑛𝑝superscript𝜈𝑁subscript𝑛𝑝subscriptproduct𝛾superscriptsubscriptsubscript𝑛𝛾0superscript𝑒subscript𝜇𝛾subscript𝑛𝛾subscript𝑛𝛾superscriptsubscript𝑣𝛾subscript𝑛𝛾\displaystyle\frac{1}{n_{p}!\nu^{Nn_{p}}}\prod_{\gamma}\sum_{n_{\gamma}=0}^{% \infty}\frac{e^{\mu_{\gamma}n_{\gamma}}}{n_{\gamma}!v_{\gamma}^{n_{\gamma}}}divide start_ARG 1 end_ARG start_ARG italic_n start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ! italic_ν start_POSTSUPERSCRIPT italic_N italic_n start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT end_POSTSUPERSCRIPT end_ARG ∏ start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT ∑ start_POSTSUBSCRIPT italic_n start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT = 0 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT ∞ end_POSTSUPERSCRIPT divide start_ARG italic_e start_POSTSUPERSCRIPT italic_μ start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT italic_n start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT end_POSTSUPERSCRIPT end_ARG start_ARG italic_n start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT ! italic_v start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_n start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT end_POSTSUPERSCRIPT end_ARG (1)
i=1np𝒟{𝐑i}j=1nγd𝐫γ,jexp{}superscriptsubscriptproduct𝑖1subscript𝑛𝑝𝒟subscript𝐑𝑖superscriptsubscriptproduct𝑗1subscript𝑛𝛾dsubscript𝐫𝛾𝑗\displaystyle\prod_{i=1}^{n_{p}}\int\mathcal{D}\{\mathbf{R}_{i}\}\int\prod_{j=% 1}^{n_{\gamma}}\mathrm{d}\mathbf{r}_{\gamma,j}\ \exp\bigg{\{}-\mathcal{H}\bigg% {\}}∏ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_n start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT end_POSTSUPERSCRIPT ∫ caligraphic_D { bold_R start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT } ∫ ∏ start_POSTSUBSCRIPT italic_j = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_n start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT end_POSTSUPERSCRIPT roman_d bold_r start_POSTSUBSCRIPT italic_γ , italic_j end_POSTSUBSCRIPT roman_exp { - caligraphic_H }
𝐫δ(ϕ^p(𝐫)+ϕ^s(𝐫)1),subscriptproduct𝐫𝛿subscript^italic-ϕ𝑝𝐫subscript^italic-ϕ𝑠𝐫1\displaystyle\prod_{\mathbf{r}}\delta(\hat{\phi}_{p}(\mathbf{r})+\hat{\phi}_{s% }(\mathbf{r})-1)~{},∏ start_POSTSUBSCRIPT bold_r end_POSTSUBSCRIPT italic_δ ( over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ( bold_r ) + over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( bold_r ) - 1 ) ,

where γ=s,±𝛾𝑠plus-or-minus\gamma=s,\pmitalic_γ = italic_s , ± represents the solvent, cations, and anions, respectively. νpsubscript𝜈𝑝\nu_{p}italic_ν start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT is the volume of each segment in the npsubscript𝑛𝑝n_{p}italic_n start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT proteins, while νγsubscript𝜈𝛾\nu_{\gamma}italic_ν start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT is the volume of each of the nγsubscript𝑛𝛾n_{\gamma}italic_n start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT small molecules. For simplicity, we assume νp=νs=νsubscript𝜈𝑝subscript𝜈𝑠𝜈\nu_{p}=\nu_{s}=\nuitalic_ν start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT = italic_ν start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT = italic_ν. 𝒟{𝐑i}𝒟subscript𝐑𝑖\mathcal{D}\{\mathbf{R}_{i}\}caligraphic_D { bold_R start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT } denotes the integration over all chain configurations of protein i𝑖iitalic_i. ϕ^p(𝐫)subscript^italic-ϕ𝑝𝐫\hat{\phi}_{p}(\mathbf{r})over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ( bold_r ) and ϕ^s(𝐫)subscript^italic-ϕ𝑠𝐫\hat{\phi}_{s}(\mathbf{r})over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( bold_r ) are the local instantaneous volume fraction of the protein and solvent, respectively. The δ𝛿\deltaitalic_δ function at the end of Eq. 1 accounts for the incompressibility. The Hamiltonian \mathcal{H}caligraphic_H is given by:

=absent\displaystyle\mathcal{H}=~{}caligraphic_H = k=1np32b20Nds(𝐑k(s)s)2superscriptsubscript𝑘1subscript𝑛𝑝32superscript𝑏2superscriptsubscript0𝑁dssuperscriptsubscript𝐑𝑘𝑠𝑠2\displaystyle\sum_{k=1}^{n_{p}}\frac{3}{2b^{2}}\int_{0}^{N}\mathrm{ds}\ \bigg{% (}\frac{\partial\mathbf{R}_{k}(s)}{\partial s}\bigg{)}^{2}∑ start_POSTSUBSCRIPT italic_k = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_n start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT end_POSTSUPERSCRIPT divide start_ARG 3 end_ARG start_ARG 2 italic_b start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT end_ARG ∫ start_POSTSUBSCRIPT 0 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_N end_POSTSUPERSCRIPT roman_ds ( divide start_ARG ∂ bold_R start_POSTSUBSCRIPT italic_k end_POSTSUBSCRIPT ( italic_s ) end_ARG start_ARG ∂ italic_s end_ARG ) start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT (2)
+1νd𝐫i=1ξ(χiϕ^i(𝐫)ϕ^s(𝐫)\displaystyle+\frac{1}{\nu}\int\mathrm{d}\mathbf{r}\ \sum_{i=1}^{\xi}\bigg{(}% \chi_{i}\hat{\phi}_{i}(\mathbf{r})\hat{\phi}_{s}(\mathbf{r})+ divide start_ARG 1 end_ARG start_ARG italic_ν end_ARG ∫ roman_d bold_r ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT ( italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( bold_r ) over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( bold_r )
+jiξχij2ϕ^i(𝐫)ϕ^j(𝐫))\displaystyle\quad\quad\quad\quad\quad\quad\quad+\sum_{j\neq i}^{\xi}\frac{% \chi_{ij}}{2}\hat{\phi}_{i}(\mathbf{r})\hat{\phi}_{j}(\mathbf{r})\bigg{)}+ ∑ start_POSTSUBSCRIPT italic_j ≠ italic_i end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT divide start_ARG italic_χ start_POSTSUBSCRIPT italic_i italic_j end_POSTSUBSCRIPT end_ARG start_ARG 2 end_ARG over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( bold_r ) over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_j end_POSTSUBSCRIPT ( bold_r ) )
+12d𝐫d𝐫ρ^c(𝐫)C(𝐫,𝐫)ρ^c(𝐫)12differential-d𝐫differential-dsuperscript𝐫subscript^𝜌𝑐𝐫𝐶𝐫superscript𝐫subscript^𝜌𝑐superscript𝐫\displaystyle+\frac{1}{2}\int\mathrm{d}\mathbf{r}\ \mathrm{d}\mathbf{r}^{% \prime}\ \ \hat{\rho}_{c}(\mathbf{r})\ C(\mathbf{r},\mathbf{r}^{\prime})\ \hat% {\rho}_{c}(\mathbf{r}^{\prime})+ divide start_ARG 1 end_ARG start_ARG 2 end_ARG ∫ roman_d bold_r roman_d bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT over^ start_ARG italic_ρ end_ARG start_POSTSUBSCRIPT italic_c end_POSTSUBSCRIPT ( bold_r ) italic_C ( bold_r , bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT ) over^ start_ARG italic_ρ end_ARG start_POSTSUBSCRIPT italic_c end_POSTSUBSCRIPT ( bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT )

which consists of three contributions: (1) the intra-chain elastic energy of IDPs, (2) the short-range hydrophobic interactions between blocks and solvents as well as cross-interactions between blocks, and (3) the long-range Coulomb interactions between charged species. ϕ^i(𝐫)subscript^italic-ϕ𝑖𝐫\hat{\phi}_{i}(\mathbf{r})over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( bold_r ) is the instantaneous volume fraction of block i𝑖iitalic_i, where ξ𝜉\xiitalic_ξ is the total number of blocks in each IDP. Thus, ϕ^p(𝐫)=i=1ξϕ^i(𝐫)subscript^italic-ϕ𝑝𝐫superscriptsubscript𝑖1𝜉subscript^italic-ϕ𝑖𝐫\hat{\phi}_{p}(\mathbf{r})=\sum_{i=1}^{\xi}\hat{\phi}_{i}(\mathbf{r})over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ( bold_r ) = ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( bold_r ). χisubscript𝜒𝑖\chi_{i}italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT is the Flory-Huggins parameter between block i𝑖iitalic_i and solvents, whereas χijsubscript𝜒𝑖𝑗\chi_{ij}italic_χ start_POSTSUBSCRIPT italic_i italic_j end_POSTSUBSCRIPT is the parameter between blocks i𝑖iitalic_i and j𝑗jitalic_j. Here, we neglect the hydrophobic interactions between different blocks, i.e., χij=0subscript𝜒𝑖𝑗0\chi_{ij}=0italic_χ start_POSTSUBSCRIPT italic_i italic_j end_POSTSUBSCRIPT = 0. Furthermore, ρ^c(𝐫)=z+c^+(𝐫)zc^(𝐫)+i=1ξαiϕ^i(𝐫)/νsubscript^𝜌𝑐𝐫subscript𝑧subscript^𝑐𝐫subscript𝑧subscript^𝑐𝐫superscriptsubscript𝑖1𝜉subscript𝛼𝑖subscript^italic-ϕ𝑖𝐫𝜈\hat{\rho}_{c}(\mathbf{r})=z_{+}\hat{c}_{+}(\mathbf{r})-z_{-}\hat{c}_{-}(% \mathbf{r})+\sum_{i=1}^{\xi}\alpha_{i}\hat{\phi}_{i}(\mathbf{r})/\nuover^ start_ARG italic_ρ end_ARG start_POSTSUBSCRIPT italic_c end_POSTSUBSCRIPT ( bold_r ) = italic_z start_POSTSUBSCRIPT + end_POSTSUBSCRIPT over^ start_ARG italic_c end_ARG start_POSTSUBSCRIPT + end_POSTSUBSCRIPT ( bold_r ) - italic_z start_POSTSUBSCRIPT - end_POSTSUBSCRIPT over^ start_ARG italic_c end_ARG start_POSTSUBSCRIPT - end_POSTSUBSCRIPT ( bold_r ) + ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( bold_r ) / italic_ν is the local charge density, where c^±(𝐫)subscript^𝑐plus-or-minus𝐫\hat{c}_{\pm}(\mathbf{r})over^ start_ARG italic_c end_ARG start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT ( bold_r ) is the instantaneous number of ions. C(𝐫,𝐫)𝐶𝐫superscript𝐫C(\mathbf{r},\mathbf{r}^{\prime})italic_C ( bold_r , bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT ) is the Coulomb operator satisfying [ϵ(𝐫)C(𝐫,𝐫)]=δ(𝐫𝐫)-\nabla\cdot\big{[}\epsilon(\mathbf{r})\nabla C(\mathbf{r},\mathbf{r}^{\prime}% )\big{]}=\delta(\mathbf{r}-\mathbf{r}{{}^{\prime}})- ∇ ⋅ [ italic_ϵ ( bold_r ) ∇ italic_C ( bold_r , bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT ) ] = italic_δ ( bold_r - bold_r start_FLOATSUPERSCRIPT ′ end_FLOATSUPERSCRIPT ). ϵ(𝐫)=kTϵ0ϵr(𝐫)/e2italic-ϵ𝐫𝑘𝑇subscriptitalic-ϵ0subscriptitalic-ϵ𝑟𝐫superscript𝑒2\epsilon(\mathbf{r})=kT\epsilon_{0}\epsilon_{r}(\mathbf{r})/e^{2}italic_ϵ ( bold_r ) = italic_k italic_T italic_ϵ start_POSTSUBSCRIPT 0 end_POSTSUBSCRIPT italic_ϵ start_POSTSUBSCRIPT italic_r end_POSTSUBSCRIPT ( bold_r ) / italic_e start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT is the scaled permittivity, where ϵ0subscriptitalic-ϵ0\epsilon_{0}italic_ϵ start_POSTSUBSCRIPT 0 end_POSTSUBSCRIPT is the vacuum permittivity, e𝑒eitalic_e is the elementary charge, and ϵr(𝐫)subscriptitalic-ϵ𝑟𝐫\epsilon_{r}(\mathbf{r})italic_ϵ start_POSTSUBSCRIPT italic_r end_POSTSUBSCRIPT ( bold_r ) is the local dielectric constant which depends on the local composition of the system.

We follow the standard self-consistent field procedure 48, 49, 50, 51, 52 (see Sec. II in the SI for the detailed derivation). First, the interacting system is decoupled into non-interacting proteins and ions in fluctuating fields by identity transformations and the Hubbard-Stratonovich transformation. Next, the functional integral over the fluctuating fields is replaced by the saddle-point approximation. The resulting self-consistent equations for block density ϕisubscriptitalic-ϕ𝑖\phi_{i}italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT, electrostatic potential ψ𝜓\psiitalic_ψ, and conjugate fields wisubscript𝑤𝑖w_{i}italic_w start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT and wssubscript𝑤𝑠w_{s}italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT are:

wi(𝐫)ws(𝐫)=χi(1ϕp(𝐫))αiψ(𝐫)subscript𝑤𝑖𝐫subscript𝑤𝑠𝐫subscript𝜒𝑖1subscriptitalic-ϕ𝑝𝐫subscript𝛼𝑖𝜓𝐫\displaystyle w_{i}(\mathbf{r})-w_{s}(\mathbf{r})=\chi_{i}(1-\phi_{p}(\mathbf{% r}))-\alpha_{i}\psi(\mathbf{r})italic_w start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( bold_r ) - italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( bold_r ) = italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( 1 - italic_ϕ start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ( bold_r ) ) - italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ψ ( bold_r ) (3a)
ϵ(𝐫)ϕi|ψ(𝐫)|22νi=1ξχiϕi(𝐫)italic-ϵ𝐫subscriptitalic-ϕ𝑖superscript𝜓𝐫22𝜈superscriptsubscript𝑖1𝜉subscript𝜒𝑖subscriptitalic-ϕ𝑖𝐫\displaystyle\quad\quad\quad\quad-\frac{\partial\epsilon(\mathbf{r})}{\partial% \phi_{i}}\frac{\lvert\nabla\psi(\mathbf{r})\rvert^{2}}{2}\nu-{\textstyle\sum_{% i=1}^{\xi}}\chi_{i}\phi_{i}(\mathbf{r})- divide start_ARG ∂ italic_ϵ ( bold_r ) end_ARG start_ARG ∂ italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT end_ARG divide start_ARG | ∇ italic_ψ ( bold_r ) | start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT end_ARG start_ARG 2 end_ARG italic_ν - ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( bold_r )
ϕi(𝐫)=npQpj=0i1Njj=0iNjdsq(𝐫;s)qc(𝐫;s)subscriptitalic-ϕ𝑖𝐫subscript𝑛𝑝subscript𝑄𝑝superscriptsubscriptsuperscriptsubscript𝑗0𝑖1subscript𝑁𝑗superscriptsubscript𝑗0𝑖subscript𝑁𝑗ds𝑞𝐫ssubscript𝑞𝑐𝐫s\displaystyle\phi_{i}(\mathbf{r})=\frac{n_{p}}{Q_{p}}\int_{\sum_{j=0}^{i-1}N_{% j}}^{\sum_{j=0}^{i}N_{j}}\mathrm{ds}\ q(\mathbf{r};\mathrm{s})q_{c}(\mathbf{r}% ;\mathrm{s})italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( bold_r ) = divide start_ARG italic_n start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT end_ARG start_ARG italic_Q start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT end_ARG ∫ start_POSTSUBSCRIPT ∑ start_POSTSUBSCRIPT italic_j = 0 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_i - 1 end_POSTSUPERSCRIPT italic_N start_POSTSUBSCRIPT italic_j end_POSTSUBSCRIPT end_POSTSUBSCRIPT start_POSTSUPERSCRIPT ∑ start_POSTSUBSCRIPT italic_j = 0 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_i end_POSTSUPERSCRIPT italic_N start_POSTSUBSCRIPT italic_j end_POSTSUBSCRIPT end_POSTSUPERSCRIPT roman_ds italic_q ( bold_r ; roman_s ) italic_q start_POSTSUBSCRIPT italic_c end_POSTSUBSCRIPT ( bold_r ; roman_s ) (3b)
1ϕp(𝐫)=eμsexp(ws(𝐫))1subscriptitalic-ϕ𝑝𝐫superscript𝑒subscript𝜇𝑠subscript𝑤𝑠𝐫\displaystyle 1-\phi_{p}(\mathbf{r})=e^{\mu_{s}}\exp(-w_{s}(\mathbf{r}))1 - italic_ϕ start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ( bold_r ) = italic_e start_POSTSUPERSCRIPT italic_μ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT end_POSTSUPERSCRIPT roman_exp ( - italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( bold_r ) ) (3c)
(ϵ(𝐫)ψ(𝐫))=italic-ϵ𝐫𝜓𝐫absent\displaystyle-\nabla\cdot\big{(}\epsilon(\mathbf{r})\nabla\psi(\mathbf{r})\big% {)}=- ∇ ⋅ ( italic_ϵ ( bold_r ) ∇ italic_ψ ( bold_r ) ) = (3d)
z+c+(𝐫)zc(𝐫)+i=1ξαiνϕi(𝐫)subscript𝑧subscript𝑐𝐫subscript𝑧subscript𝑐𝐫superscriptsubscript𝑖1𝜉subscript𝛼𝑖𝜈subscriptitalic-ϕ𝑖𝐫\displaystyle\quad\quad\quad\quad z_{+}c_{+}(\mathbf{r})-z_{-}c_{-}(\mathbf{r}% )+{\textstyle\sum_{i=1}^{\xi}}\frac{\alpha_{i}}{\nu}\phi_{i}(\mathbf{r})italic_z start_POSTSUBSCRIPT + end_POSTSUBSCRIPT italic_c start_POSTSUBSCRIPT + end_POSTSUBSCRIPT ( bold_r ) - italic_z start_POSTSUBSCRIPT - end_POSTSUBSCRIPT italic_c start_POSTSUBSCRIPT - end_POSTSUBSCRIPT ( bold_r ) + ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT divide start_ARG italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT end_ARG start_ARG italic_ν end_ARG italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( bold_r )

c±=λ±exp(z±ψ)subscript𝑐plus-or-minussubscript𝜆plus-or-minusminus-or-plussubscript𝑧plus-or-minus𝜓c_{\pm}=\lambda_{\pm}\exp(\mp z_{\pm}\psi)italic_c start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT = italic_λ start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT roman_exp ( ∓ italic_z start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT italic_ψ ) is the ion concentration, where λ±=eμ±/ν±subscript𝜆plus-or-minussuperscript𝑒subscript𝜇plus-or-minussubscript𝜈plus-or-minus\lambda_{\pm}=e^{\mu_{\pm}}/\nu_{\pm}italic_λ start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT = italic_e start_POSTSUPERSCRIPT italic_μ start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT end_POSTSUPERSCRIPT / italic_ν start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT is the fugacity of the ions determined by the bulk ion concentration c±bsuperscriptsubscript𝑐plus-or-minus𝑏c_{\pm}^{b}italic_c start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_b end_POSTSUPERSCRIPT. Qs=ν1d𝐫exp(ws)subscript𝑄𝑠superscript𝜈1differential-d𝐫subscript𝑤𝑠Q_{s}=\nu^{-1}\int\mathrm{d}\mathbf{r}\ \exp{(-w_{s})}italic_Q start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT = italic_ν start_POSTSUPERSCRIPT - 1 end_POSTSUPERSCRIPT ∫ roman_d bold_r roman_exp ( - italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ) is the single-particle partition function of the solvent. Qp=ν1d𝐫q(𝐫;s)subscript𝑄𝑝superscript𝜈1differential-d𝐫𝑞𝐫sQ_{p}=\nu^{-1}\int\mathrm{d}\mathbf{r}\ q(\mathbf{r};\mathrm{s})italic_Q start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT = italic_ν start_POSTSUPERSCRIPT - 1 end_POSTSUPERSCRIPT ∫ roman_d bold_r italic_q ( bold_r ; roman_s ) is the single-chain partition function of the protein. q(𝐫;s)𝑞𝐫sq(\mathbf{r};\mathrm{s})italic_q ( bold_r ; roman_s ) is the propagator which satisfies the modified diffusion equation:

sq(𝐫;\displaystyle\frac{\partial}{\partial s}q(\mathbf{r};divide start_ARG ∂ end_ARG start_ARG ∂ italic_s end_ARG italic_q ( bold_r ; s)=b262q(𝐫;s)wi(𝐫)q(𝐫;s),\displaystyle\mathrm{s})=\frac{b^{2}}{6}\nabla^{2}q(\mathbf{r};s)-w_{i}(% \mathbf{r})q(\mathbf{r};s)\;,roman_s ) = divide start_ARG italic_b start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT end_ARG start_ARG 6 end_ARG ∇ start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT italic_q ( bold_r ; italic_s ) - italic_w start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( bold_r ) italic_q ( bold_r ; italic_s ) , (4)
where wi(𝐫)=subscript𝑤𝑖𝐫absent\displaystyle w_{i}(\mathbf{r})=italic_w start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( bold_r ) =
{w1(𝐫)for s=[0,N1]wξ(𝐫)for s=[j=0ξ1Nj,j=0ξNj]casessubscript𝑤1𝐫for 𝑠0subscript𝑁1otherwisesubscript𝑤𝜉𝐫for 𝑠superscriptsubscript𝑗0𝜉1subscript𝑁𝑗superscriptsubscript𝑗0𝜉subscript𝑁𝑗\displaystyle\begin{cases}w_{1}(\mathbf{r})&\text{for }s=[0,N_{1}]\\ &\vdots\\ w_{\xi}(\mathbf{r})&\text{for }s=[\sum_{j=0}^{\xi-1}N_{j},\sum_{j=0}^{\xi}N_{j% }]\end{cases}{ start_ROW start_CELL italic_w start_POSTSUBSCRIPT 1 end_POSTSUBSCRIPT ( bold_r ) end_CELL start_CELL for italic_s = [ 0 , italic_N start_POSTSUBSCRIPT 1 end_POSTSUBSCRIPT ] end_CELL end_ROW start_ROW start_CELL end_CELL start_CELL ⋮ end_CELL end_ROW start_ROW start_CELL italic_w start_POSTSUBSCRIPT italic_ξ end_POSTSUBSCRIPT ( bold_r ) end_CELL start_CELL for italic_s = [ ∑ start_POSTSUBSCRIPT italic_j = 0 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ - 1 end_POSTSUPERSCRIPT italic_N start_POSTSUBSCRIPT italic_j end_POSTSUBSCRIPT , ∑ start_POSTSUBSCRIPT italic_j = 0 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT italic_N start_POSTSUBSCRIPT italic_j end_POSTSUBSCRIPT ] end_CELL end_ROW

While our theory is general for any geometry of the system, here we consider a one-dimensional planar system, where the protein densities vary only in the z𝑧zitalic_z-direction but remain homogeneous in the xy𝑥𝑦xyitalic_x italic_y-plane. The initial condition for the tethered end of the protein is thus q(z;0)=δ(zz)𝑞z0𝛿𝑧superscript𝑧q(\mathrm{z};0)=\delta(z-z^{*})italic_q ( roman_z ; 0 ) = italic_δ ( italic_z - italic_z start_POSTSUPERSCRIPT ∗ end_POSTSUPERSCRIPT ), where z0+superscript𝑧limit-from0z^{*}\to 0+italic_z start_POSTSUPERSCRIPT ∗ end_POSTSUPERSCRIPT → 0 +. qc(z;s)subscript𝑞𝑐z𝑠q_{c}(\mathrm{z};s)italic_q start_POSTSUBSCRIPT italic_c end_POSTSUBSCRIPT ( roman_z ; italic_s ) in Eq. 3b is introduced as the complementary propagator starting at the free end which also satisfies the same modified diffusion equation (Eq. 4) as q(z;s)𝑞z𝑠q(\mathrm{z};s)italic_q ( roman_z ; italic_s ) but with the initial condition qc(z,N)=1subscript𝑞𝑐z𝑁1q_{c}(\mathrm{z},N)=1italic_q start_POSTSUBSCRIPT italic_c end_POSTSUBSCRIPT ( roman_z , italic_N ) = 1. We assume that there is no interaction between proteins and the substrate. The boundary condition corresponding to this non-interacting surface is to set the protein density of each block ϕisubscriptitalic-ϕ𝑖\phi_{i}italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT to zero. The gradient of the electrostatic potential is also set to zero on the substrate. The free energy per unit area is:

F=𝐹absent\displaystyle F=italic_F = σlnQpeμsQs𝜎subscript𝑄𝑝superscript𝑒subscript𝜇𝑠subscript𝑄𝑠\displaystyle-\sigma\ln Q_{p}-e^{\mu_{s}}Q_{s}- italic_σ roman_ln italic_Q start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT - italic_e start_POSTSUPERSCRIPT italic_μ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT end_POSTSUPERSCRIPT italic_Q start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT (5)
+1νdz[i=1ξ(χiϕi(1ϕp)wiϕi)\displaystyle+\frac{1}{\nu}\int\mathrm{dz}\ \bigg{[}\sum_{i=1}^{\xi}\bigg{(}% \chi_{i}\phi_{i}(1-\phi_{p})-w_{i}\phi_{i}\bigg{)}+ divide start_ARG 1 end_ARG start_ARG italic_ν end_ARG ∫ roman_dz [ ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT ( italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( 1 - italic_ϕ start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ) - italic_w start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT )
ws(1ϕp)]+dz[ϵ2|ψ|2\displaystyle-w_{s}(1-\phi_{p})\bigg{]}+\int\mathrm{dz}\ \bigg{[}-\frac{% \epsilon}{2}\lvert\nabla\psi\rvert^{2}- italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( 1 - italic_ϕ start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ) ] + ∫ roman_dz [ - divide start_ARG italic_ϵ end_ARG start_ARG 2 end_ARG | ∇ italic_ψ | start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT
+ψνi=1ξαiϕic+c],\displaystyle\quad\quad\quad\quad\quad\quad\quad+\frac{\psi}{\nu}\sum_{i=1}^{% \xi}\alpha_{i}\phi_{i}-c_{+}-c_{-}\bigg{]}~{},+ divide start_ARG italic_ψ end_ARG start_ARG italic_ν end_ARG ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT - italic_c start_POSTSUBSCRIPT + end_POSTSUBSCRIPT - italic_c start_POSTSUBSCRIPT - end_POSTSUBSCRIPT ] ,

where σ𝜎\sigmaitalic_σ denotes the grafting density of proteins on the surface.

The equilibrium protein density profile, electrostatic field, and ion distribution can be obtained by solving Eq. 3 and Eq. 4 iteratively. The height of the brush H𝐻Hitalic_H is extracted from the protein density profile based on the Gibbs dividing surface 53, 54:

H=20zϕp(z)dz0ϕp(z)dz𝐻2superscriptsubscript0𝑧subscriptitalic-ϕ𝑝zdzsuperscriptsubscript0subscriptitalic-ϕ𝑝zdzH=\frac{2\int_{0}^{\infty}z\phi_{p}(\mathrm{z})\mathrm{dz}\ }{\int_{0}^{\infty% }\phi_{p}(\mathrm{z})\mathrm{dz}\ }italic_H = divide start_ARG 2 ∫ start_POSTSUBSCRIPT 0 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT ∞ end_POSTSUPERSCRIPT italic_z italic_ϕ start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ( roman_z ) roman_dz end_ARG start_ARG ∫ start_POSTSUBSCRIPT 0 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT ∞ end_POSTSUPERSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ( roman_z ) roman_dz end_ARG (6)

Compared to the lattice constraint invoked in previous work 37, 38, 41, the differential equations are solved in the continuous space, where the numerical discretization is decoupled from the physical lattice. This improves the flexibility of the calculations 55. An iterative, centered finite difference scheme is used to solve the Poisson-Boltzmann equation (Eq. 3d), whereas the Crank-Nicolson scheme 56 is used to solve the modified diffusion equation (Eq. 4). Our theory can be easily generalized to consider brushes with protein mixtures, various chain architectures, and morphologies with inhomogeneity in multiple dimensions.

3 Results and Discussion

The theory presented above can be applied to any amino acid sequence. Here, we focus on the effect of ionic strength on a planar brush comprised of modified NFH sidearms at pH 2.4. According to this bulk proton concentration, the ionic strength (I=12izi2ci𝐼12subscript𝑖superscriptsubscript𝑧𝑖2subscript𝑐𝑖I=\frac{1}{2}\sum_{i}z_{i}^{2}c_{i}italic_I = divide start_ARG 1 end_ARG start_ARG 2 end_ARG ∑ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_z start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT italic_c start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT for ion species i𝑖iitalic_i) for the salt-free system is thus 4 mM. For consistency with the setup in the experiments of the Kumar group 20, we consider the same grafting density σ=0.02nm2𝜎0.02superscriptnm2\sigma=0.02\ \mathrm{nm}^{-2}italic_σ = 0.02 roman_nm start_POSTSUPERSCRIPT - 2 end_POSTSUPERSCRIPT and the addition of monovalent salt (z±=1subscript𝑧plus-or-minus1z_{\pm}=1italic_z start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT = 1). For simplicity, the dielectric constant of the system is assumed to be uniform and set to be ϵr=80subscriptitalic-ϵ𝑟80\epsilon_{r}=80italic_ϵ start_POSTSUBSCRIPT italic_r end_POSTSUBSCRIPT = 80, the value of water. The temperature is set at 293 K, yielding a Bjerrum length lB=e2/4πkTϵ0ϵrsubscript𝑙𝐵superscript𝑒24𝜋𝑘𝑇subscriptitalic-ϵ0subscriptitalic-ϵ𝑟l_{B}=e^{2}/4\pi kT\epsilon_{0}\epsilon_{r}italic_l start_POSTSUBSCRIPT italic_B end_POSTSUBSCRIPT = italic_e start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT / 4 italic_π italic_k italic_T italic_ϵ start_POSTSUBSCRIPT 0 end_POSTSUBSCRIPT italic_ϵ start_POSTSUBSCRIPT italic_r end_POSTSUBSCRIPT of 0.70.70.70.7 nm.

3.1 Morphological Response to Ionic Strength

Refer to caption
Figure 2: Height response of NFH brushes at pH 2.4 to various ionic strengths I𝐼Iitalic_I. H~~𝐻\tilde{H}over~ start_ARG italic_H end_ARG is the normalized brush height defined using the value under the salt-free condition as a reference. The theoretical prediction (solid line) is compared to the experimental results (circles) reported by the Kumar group 20. The inset plots H~~𝐻\tilde{H}over~ start_ARG italic_H end_ARG as a function of the Debye screening length κD1superscriptsubscript𝜅𝐷1\kappa_{D}^{-1}italic_κ start_POSTSUBSCRIPT italic_D end_POSTSUBSCRIPT start_POSTSUPERSCRIPT - 1 end_POSTSUPERSCRIPT to illustrate the scaling behavior at high κD1superscriptsubscript𝜅𝐷1\kappa_{D}^{-1}italic_κ start_POSTSUBSCRIPT italic_D end_POSTSUBSCRIPT start_POSTSUPERSCRIPT - 1 end_POSTSUPERSCRIPT. b=3.00nm𝑏3.00nmb=3.00\ \mathrm{nm}italic_b = 3.00 roman_nm and ν=1.30nm3𝜈1.30superscriptnm3\nu=1.30\ \mathrm{nm^{3}}italic_ν = 1.30 roman_nm start_POSTSUPERSCRIPT 3 end_POSTSUPERSCRIPT are adopted for the best fit to experimental data.

The morphology of NFH brushes is determined by the interplay between the hydrophobic interaction, screened electrostatic repulsion, and conformational entropy of grafted proteins. Fig. 2 shows that, after properly choosing model parameters b𝑏bitalic_b and ν𝜈\nuitalic_ν, the height response predicted by our theory is in good agreement with the experimental results reported in the literature for NFH brushes at 2.4 pH over a wide range of ionic strengths 20. Here, the brush heights are normalized by the value under the salt-free condition (i.e., H=33𝐻33H=33italic_H = 33 nm at I=4𝐼4I=4italic_I = 4 mM) for a better comparison to the experimental values. We note that the experimental heights measured by the Kumar group were normalized by 57 nm 20. The difference of the brush height in the salt-free case between experiment and theory could be attributed to the methods for quantifying the brush height. The experimental heights were determined using atomic force microscopy, while our theoretical work uses the Gibbs dividing surface, as defined in Eq. 6. The height response of NFH brushes to increasing ionic strength can be divided into three regimes. At very low ionic strengths (I<4𝐼4I<4italic_I < 4 mM or κD1>4.8superscriptsubscript𝜅𝐷14.8\kappa_{D}^{-1}>4.8italic_κ start_POSTSUBSCRIPT italic_D end_POSTSUBSCRIPT start_POSTSUPERSCRIPT - 1 end_POSTSUPERSCRIPT > 4.8 nm, where κD1superscriptsubscript𝜅𝐷1\kappa_{D}^{-1}italic_κ start_POSTSUBSCRIPT italic_D end_POSTSUBSCRIPT start_POSTSUPERSCRIPT - 1 end_POSTSUPERSCRIPT is the Debye screening length defined as κD1=(8πlBI)1/2superscriptsubscript𝜅𝐷1superscript8𝜋subscript𝑙𝐵𝐼12\kappa_{D}^{-1}=(8\pi l_{B}I)^{-1/2}italic_κ start_POSTSUBSCRIPT italic_D end_POSTSUBSCRIPT start_POSTSUPERSCRIPT - 1 end_POSTSUPERSCRIPT = ( 8 italic_π italic_l start_POSTSUBSCRIPT italic_B end_POSTSUBSCRIPT italic_I ) start_POSTSUPERSCRIPT - 1 / 2 end_POSTSUPERSCRIPT), the normalized height H~~𝐻\tilde{H}over~ start_ARG italic_H end_ARG decreases as I𝐼Iitalic_I increases. The theoretical results follow the scaling of H~κD2/3similar-to~𝐻superscriptsubscript𝜅𝐷23\tilde{H}\sim\kappa_{D}^{-2/3}over~ start_ARG italic_H end_ARG ∼ italic_κ start_POSTSUBSCRIPT italic_D end_POSTSUBSCRIPT start_POSTSUPERSCRIPT - 2 / 3 end_POSTSUPERSCRIPT as shown in the inset of Fig. 2, consistent with the picture of the Alexander-de Gennes model for strongly stretched brushes. In the intermediate regime of 4444 mM <I<6absent𝐼6<I<6< italic_I < 6 mM, the brushes collapse dramatically when a small amount of monovalent salt is added. H~~𝐻\tilde{H}over~ start_ARG italic_H end_ARG decreases by a factor of 3 within a narrow ionic strength range of 2 mM, which fully captures the dramatic height change observed in experiments. From I=6𝐼6I=6italic_I = 6 mM onwards, the height decrease slows until the charges carried by the proteins are completely screened and the brush morphology eventually approaches that of a condensed, charge-neutral brush.

We note that there are some discrepancies between theory and experiments at very low and very high ionic strengths. This may be attributed to the simplified treatment of the dielectric environment in the current work, where the dielectric permittivities of the solvent, protein, and substrate are not distinguished. At low ionic strength, the image force due to the dielectric contrast between the substrate and solvent will repel ions further away from the surface, leading to less screening and higher brush height. At the other limit of high ionic strength, proteins form a dense layer near the surface. Since the dielectric constants of proteins are usually much lower than that of water, the strength of the ionic screening (κ(2I/ϵr)1/2similar-to𝜅superscript2𝐼subscriptitalic-ϵ𝑟12\kappa\sim(2I/\epsilon_{r})^{1/2}italic_κ ∼ ( 2 italic_I / italic_ϵ start_POSTSUBSCRIPT italic_r end_POSTSUBSCRIPT ) start_POSTSUPERSCRIPT 1 / 2 end_POSTSUPERSCRIPT) is higher than the theoretical prediction, giving rise to a lower brush height.

Refer to caption
Figure 3: Representative distributions of the overall density of NFH proteins ϕpsubscriptitalic-ϕ𝑝\phi_{p}italic_ϕ start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT for I=4,6,10,𝐼4610I=4,6,10,italic_I = 4 , 6 , 10 , and 50505050 mM. z𝑧zitalic_z denotes the direction perpendicular to the grafting surface.

Fig. 3 depicts the representative protein density profiles underlying the overall brush height. The corresponding ionic density profiles are provided in Sec. IV of the SI. At low ionic strengths (e.g., I=4𝐼4I=4italic_I = 4 mM), the intrachain electrostatic repulsion is dominant. Each protein adopts a strongly stretched conformation which leads to a swollen brush morphology. The protein density distribution is quite diffuse with a pronounced tail stretching into the solution. The peak is attributed to the aggregation of less charged residues near the grafting point. In stark contrast, at high ionic strength (e.g., I=50𝐼50I=50italic_I = 50 mM), the charges on the protein are largely screened, whereas hydrophobic attraction between residues is dominant. Each protein chain collapses and thus the whole brush adopts a condensed morphology. This is reflected by the single sharp peak in the density profile. Furthermore, at intermediate ionic strengths between the two limiting regimes, e.g., I=6𝐼6I=6italic_I = 6 and 10101010 mM, brushes exhibit characteristics of both the swollen morphology and the condensed morphology: there is a coexistence between a diffuse outer layer and a dense inner layer. In fact, the dramatic height change from 4 mM to 6 mM originates from the morphological transition from a swollen brush to a coexisting brush.

\phantomsubcaption
\phantomsubcaption
\phantomsubcaptionRefer to caption
Figure 4: The morphology of coexisting brushes. The density distribution of (a) Block 3 and (b) Block 5 at I=6𝐼6I=6italic_I = 6 and 10 mM. (c) Schematic of the coexisting brush morphology with two populations of chain conformations. Block 3 and Block 5 are highlighted by red and blue, respectively, for illustration.

Our theory facilitates the calculation of the density distribution of each constituent protein residue, which enables us to further elucidate the microstructure of the coexisting morphology. In our multi-block charged macromolecular model, this corresponds to the density distribution of a particular block as indicated by Eq. 3b. Fig. 4 shows the distribution of two representative blocks at I=6𝐼6I=6italic_I = 6 and 10101010 mM. Block 3 (Fig. 4) is the middle block less affected by the grafted chain end and is moderately charged. Block 5 (Fig. 4) is the ending block which contains the free chain end and is the most positively charged among all the blocks. As shown in Fig. 4, these two blocks exhibit remarkably different responses to changing I𝐼Iitalic_I. Block 3 remains collapsed in the inner condensed layer. Its density distribution is largely insensitive to I𝐼Iitalic_I, only with a slight compression at 10 mM due to the increase of electrostatic screening. On the other hand, the distribution of Block 5 is bimodal, signifying its presence both in the inner condensed layer and in the outer diffuse layer. In stark contrast to Block 3, the density distribution of Block 5 changes significantly with I𝐼Iitalic_I. As I𝐼Iitalic_I increases from 6 mM to 10 mM, a pronounced fraction of residues move from the outer diffuse layer to the inner condensed layer. The density of remaining residues in the outer layer shrinks significantly, which is reflected by a decrease of the brush height as shown in Fig. 2.

\phantomsubcaption
\phantomsubcaption
\phantomsubcaption
\phantomsubcaptionRefer to caption
Figure 5: (a) A fully swollen brush, (b) a coexisting brush with overlapping proteins in the outer layer, (c) a coexisting brush with isolated proteins in the outer layer, and (d) a fully condensed brush.

The features of the distributions of Block 3 and Block 5 illustrate that the coexisting brushes consist of two populations of chains, collapsed and stretched, as shown by the schematic in Fig. 4. The inner condensed layer is comprised of all the collapsed chains and the beginning portion of the stretched chains, whereas the outer diffuse layer includes only the remaining portion of the stretched chains. As I𝐼Iitalic_I increases, the population of stretched chains transfers to that of the collapsed conformation. Only the stretched conformation is sensitive to the ionic strength, which becomes less extended as screening strength increases. This underlying picture of the coexisting morphology in NFH brushes is consistent with previous theoretical and experimental results observed in synthetic polyelectrolyte brushes 57, 58.

The insight obtained by studying the morphology of coexisting brushes helps to explain the dramatic height change in response to ionic strength, as observed in Fig. 2 and in the experiments of the Kumar group 20. At very low ionic strengths (I<4𝐼4I<4italic_I < 4 mM), all NFH proteins within the brushes take the stretched conformation, as shown in Fig. 5. At the critical ionic strength I=4𝐼4I=4italic_I = 4 mM, the screened electrostatic repulsion is comparable to the hydrophobic attraction such that individual proteins have a noticeable probability to transfer to the collapsed conformation. With increasing I𝐼Iitalic_I, the number of proteins in the collapsed conformation increases, leading to the formation of the condensed inner layer of the coexisting brush. The outer layer of the coexisting brush can be viewed as being ”grafted” upon the inner layer with effective grafting density σoutsubscript𝜎𝑜𝑢𝑡\sigma_{out}italic_σ start_POSTSUBSCRIPT italic_o italic_u italic_t end_POSTSUBSCRIPT. Particularly, at I=4𝐼4I=4italic_I = 4 mM, σoutσsubscript𝜎𝑜𝑢𝑡𝜎\sigma_{out}\approx\sigmaitalic_σ start_POSTSUBSCRIPT italic_o italic_u italic_t end_POSTSUBSCRIPT ≈ italic_σ because almost all the proteins remain in the stretched conformation. For 4 mM <I<6absent𝐼6<I<6< italic_I < 6 mM, σoutsubscript𝜎𝑜𝑢𝑡\sigma_{out}italic_σ start_POSTSUBSCRIPT italic_o italic_u italic_t end_POSTSUBSCRIPT drops dramatically as a significant number of stretched proteins collapse into the inner layer. However, as shown in Fig. 5, σoutsubscript𝜎𝑜𝑢𝑡\sigma_{out}italic_σ start_POSTSUBSCRIPT italic_o italic_u italic_t end_POSTSUBSCRIPT is still large enough such that proteins in the outer layer remain overlapped with each other. According to the Alexander-de Gennes model for the overlapping brush, the brush height is proportional to the effective grafting density, i.e. Hσoutsimilar-to𝐻subscript𝜎𝑜𝑢𝑡H\sim\sigma_{out}italic_H ∼ italic_σ start_POSTSUBSCRIPT italic_o italic_u italic_t end_POSTSUBSCRIPT, which explains the dramatic height decrease in this regime 59. For I>6𝐼6I>6italic_I > 6 mM, σoutsubscript𝜎𝑜𝑢𝑡\sigma_{out}italic_σ start_POSTSUBSCRIPT italic_o italic_u italic_t end_POSTSUBSCRIPT continues decreasing such that the distance between stretched proteins is larger than the pervaded size of individual proteins in the lateral direction (i.e., σout1/2>Rg,xysimilar-toabsentsuperscriptsubscript𝜎𝑜𝑢𝑡12subscript𝑅𝑔𝑥𝑦\sim\sigma_{out}^{-1/2}>R_{g,xy}∼ italic_σ start_POSTSUBSCRIPT italic_o italic_u italic_t end_POSTSUBSCRIPT start_POSTSUPERSCRIPT - 1 / 2 end_POSTSUPERSCRIPT > italic_R start_POSTSUBSCRIPT italic_g , italic_x italic_y end_POSTSUBSCRIPT). As shown in Fig. 5, proteins in the outer layer behave isolated in this regime, and the brush height is thus insensitive to the further decrease of grafting density, i.e., Hσout0similar-to𝐻superscriptsubscript𝜎𝑜𝑢𝑡0H\sim\sigma_{out}^{0}italic_H ∼ italic_σ start_POSTSUBSCRIPT italic_o italic_u italic_t end_POSTSUBSCRIPT start_POSTSUPERSCRIPT 0 end_POSTSUPERSCRIPT. The slow decrease of H𝐻Hitalic_H as I𝐼Iitalic_I increases in this regime is solely attributed to the screening effect on the electrostatic repulsion of the stretched proteins. At very high ionic strengths I>50𝐼50I>50italic_I > 50 mM, the electrostatic repulsion is highly screened, which leads to the collapse of all the proteins and the eventual disappearance of the outer diffuse layer (see Fig. 5). Therefore, the dramatic height change characterizes the transition from the overlapping state to the isolated state in the outer layer of the coexisting brush induced by the electrostatic screening effect.

3.2 Characterization of Microstructure from Scattering and Force Spectra

Refer to caption
Figure 6: Reflectivity spectra of NFH brushes at different ionic strengths calculated using protein density profiles. The reflected intensity R𝑅Ritalic_R (normalized by the Fresnel reflectivity RFsubscript𝑅𝐹R_{F}italic_R start_POSTSUBSCRIPT italic_F end_POSTSUBSCRIPT) is plotted against the specular part of the momentum transfer vector Qzsubscript𝑄𝑧Q_{z}italic_Q start_POSTSUBSCRIPT italic_z end_POSTSUBSCRIPT. For clarity, the curves are offset vertically by 100 as I𝐼Iitalic_I increases. The dashed guidelines illustrate the increase in periodicity of the oscillations.

As shown in the above subsection, NFH brushes exhibit non-trivial morphological behaviors which cannot be fully captured by the overall brush height obtained from common characterization tools such as AFM and spectroscopic ellipsometry. Reflectivity is a scattering technique which detects the detailed structure of buried layered interfaces by utilizing the interference of X-rays or neutrons in the sample. Like all other scattering techniques, it is challenging to obtain density profiles directly from reflectivity spectra because the scattering intensity is measured in reciprocal space 60, 61. The intensity R𝑅Ritalic_R of a reflected X-ray beam as a function of the specular part of the momentum transfer vector Qzsubscript𝑄𝑧Q_{z}italic_Q start_POSTSUBSCRIPT italic_z end_POSTSUBSCRIPT and the gradient of the electron density distribution dρe(z)/dz𝑑subscript𝜌𝑒𝑧𝑑𝑧d\rho_{e}(z)/dzitalic_d italic_ρ start_POSTSUBSCRIPT italic_e end_POSTSUBSCRIPT ( italic_z ) / italic_d italic_z is given by:

R(Qz)=RF|1ρedzdρe(z)dzexp(iQzz)|2,𝑅subscript𝑄𝑧subscript𝑅𝐹superscript1superscriptsubscript𝜌𝑒dz𝑑subscript𝜌𝑒𝑧𝑑𝑧𝑖subscript𝑄𝑧𝑧2R(Q_{z})=R_{F}\left|\frac{1}{\rho_{e}^{\infty}}\int\textrm{dz}\ \frac{d\rho_{e% }(z)}{dz}\exp{(iQ_{z}z)}\right|^{2},italic_R ( italic_Q start_POSTSUBSCRIPT italic_z end_POSTSUBSCRIPT ) = italic_R start_POSTSUBSCRIPT italic_F end_POSTSUBSCRIPT | divide start_ARG 1 end_ARG start_ARG italic_ρ start_POSTSUBSCRIPT italic_e end_POSTSUBSCRIPT start_POSTSUPERSCRIPT ∞ end_POSTSUPERSCRIPT end_ARG ∫ dz divide start_ARG italic_d italic_ρ start_POSTSUBSCRIPT italic_e end_POSTSUBSCRIPT ( italic_z ) end_ARG start_ARG italic_d italic_z end_ARG roman_exp ( italic_i italic_Q start_POSTSUBSCRIPT italic_z end_POSTSUBSCRIPT italic_z ) | start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT , (7)

where RFsubscript𝑅𝐹R_{F}italic_R start_POSTSUBSCRIPT italic_F end_POSTSUBSCRIPT represents the Fresnel reflectivity of an ideal, sharp surface and ρesuperscriptsubscript𝜌𝑒\rho_{e}^{\infty}italic_ρ start_POSTSUBSCRIPT italic_e end_POSTSUBSCRIPT start_POSTSUPERSCRIPT ∞ end_POSTSUPERSCRIPT is the electron density of the bulk media far away from the substrate 62. Here, we take ρe=ρe,s=0.33eÅ3superscriptsubscript𝜌𝑒subscript𝜌𝑒𝑠0.33𝑒superscriptÅ3\rho_{e}^{\infty}=\rho_{e,s}=0.33\ e\ \mathrm{\textup{\AA}}^{-3}italic_ρ start_POSTSUBSCRIPT italic_e end_POSTSUBSCRIPT start_POSTSUPERSCRIPT ∞ end_POSTSUPERSCRIPT = italic_ρ start_POSTSUBSCRIPT italic_e , italic_s end_POSTSUBSCRIPT = 0.33 italic_e Å start_POSTSUPERSCRIPT - 3 end_POSTSUPERSCRIPT as the value of water. The local electron density ρe(z)subscript𝜌𝑒𝑧\rho_{e}(z)italic_ρ start_POSTSUBSCRIPT italic_e end_POSTSUBSCRIPT ( italic_z ) can be calculated from the distribution of each species α𝛼\alphaitalic_α based on the following linear combination: ρe(z)=αρe,αϕα(z)subscript𝜌𝑒𝑧subscript𝛼subscript𝜌𝑒𝛼subscriptitalic-ϕ𝛼𝑧\rho_{e}(z)=\sum_{\alpha}\rho_{e,\alpha}\phi_{\alpha}(z)italic_ρ start_POSTSUBSCRIPT italic_e end_POSTSUBSCRIPT ( italic_z ) = ∑ start_POSTSUBSCRIPT italic_α end_POSTSUBSCRIPT italic_ρ start_POSTSUBSCRIPT italic_e , italic_α end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_α end_POSTSUBSCRIPT ( italic_z ). α𝛼\alphaitalic_α includes the protein, solvent, and \chSiO2 substrate with the corresponding electron densities ρe,αsubscript𝜌𝑒𝛼\rho_{e,\alpha}italic_ρ start_POSTSUBSCRIPT italic_e , italic_α end_POSTSUBSCRIPT as 0.95 eÅ3𝑒superscriptÅ3e\ \mathrm{\textup{\AA}}^{-3}italic_e Å start_POSTSUPERSCRIPT - 3 end_POSTSUPERSCRIPT, 0.33 eÅ3𝑒superscriptÅ3e\ \mathrm{\textup{\AA}}^{-3}italic_e Å start_POSTSUPERSCRIPT - 3 end_POSTSUPERSCRIPT, and 2.32 eÅ3𝑒superscriptÅ3e\ \mathrm{\textup{\AA}}^{-3}italic_e Å start_POSTSUPERSCRIPT - 3 end_POSTSUPERSCRIPT, respectively 63.

The density profiles obtained from our theory can be used to investigate the evolution of the scattering intensity with changing ionic strength. Fig. 6 plots the reflectivity (normalized by the Fresnel reflectivity RFsubscript𝑅𝐹R_{F}italic_R start_POSTSUBSCRIPT italic_F end_POSTSUBSCRIPT) for different I𝐼Iitalic_I. At I=4𝐼4I=4italic_I = 4 mM, R(Qz)𝑅subscript𝑄𝑧R(Q_{z})italic_R ( italic_Q start_POSTSUBSCRIPT italic_z end_POSTSUBSCRIPT ) is nearly featureless, indicating the absence of any condensed layer. For I6𝐼6I\geq 6italic_I ≥ 6 mM, R(Qz)𝑅subscript𝑄𝑧R(Q_{z})italic_R ( italic_Q start_POSTSUBSCRIPT italic_z end_POSTSUBSCRIPT ) exhibits an oscillatory signature, which signifies the existence of a condensed layer. In this regime, it can be clearly seen from Fig. 6 that the ionic strength affects both the periodicity and amplitude of the oscillations. The increase in periodicity (denoted by ΔQzΔsubscript𝑄𝑧\Delta Q_{z}roman_Δ italic_Q start_POSTSUBSCRIPT italic_z end_POSTSUBSCRIPT) with I𝐼Iitalic_I indicates that the condensed layer becomes thinner since the layer thickness d𝑑ditalic_d is characterized by the inverse of the periodicity (i.e., d=2π/ΔQz𝑑2𝜋Δsubscript𝑄𝑧d=2\pi/\Delta Q_{z}italic_d = 2 italic_π / roman_Δ italic_Q start_POSTSUBSCRIPT italic_z end_POSTSUBSCRIPT). On the other hand, the increase in the amplitude of the oscillations signifies condensed layers with sharper interfaces. Using reflectivity spectroscopy, similar oscillatory signatures have been observed in neutral polymer brushes in the presence of a condensed layer 64, 65, 66. Our results demonstrate the effectiveness of reflectivity spectroscopy in detecting the morphological change of protein brushes in terms of the existence and microstructure of the condensed layer.

Refer to caption
Figure 7: Force spectra between two opposing substrates grafted with NFH brushes. The force per unit area p𝑝pitalic_p is plotted against the separation distance D𝐷Ditalic_D at different ionic strengths. Vertical dashed lines locate the discontinuous transition of two separated condensed layer from both brushes to a single, merged condensed layer. The dotted lines denote the metastable region beyond the transition point.

Another approach to obtain the brush microstructure is through characterizing its mechanical response using force spectroscopy techniques such as the surface force apparatus (SFA) 67, 68. By tracking the free energy and the corresponding brush morphology as a function of the separation distance, our theory enables the investigation of the force spectra between two opposing substrates grafted by NFH brushes. The force per unit area is quantified by the disjoining pressure p𝑝pitalic_p at a given separation D𝐷Ditalic_D between the two substrates. It is calculated from the derivative of the free energy F𝐹Fitalic_F as p=(F/D)λ±pb𝑝subscript𝐹𝐷subscript𝜆plus-or-minussubscript𝑝𝑏p=-(\partial F/\partial D)_{\lambda_{\pm}}-p_{b}italic_p = - ( ∂ italic_F / ∂ italic_D ) start_POSTSUBSCRIPT italic_λ start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT end_POSTSUBSCRIPT - italic_p start_POSTSUBSCRIPT italic_b end_POSTSUBSCRIPT, where pb=c+b+cbsubscript𝑝𝑏superscriptsubscript𝑐𝑏superscriptsubscript𝑐𝑏p_{b}=c_{+}^{b}+c_{-}^{b}italic_p start_POSTSUBSCRIPT italic_b end_POSTSUBSCRIPT = italic_c start_POSTSUBSCRIPT + end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_b end_POSTSUPERSCRIPT + italic_c start_POSTSUBSCRIPT - end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_b end_POSTSUPERSCRIPT is the bulk osmotic pressure from the connected reservoir. Fig. 7 shows the force spectra for different ionic strengths. For all I𝐼Iitalic_I, the force is repulsive (i.e. p>0𝑝0p>0italic_p > 0) at large separations as a result of the dominant electrostatic repulsion in this region. It is interesting to note that a signature of a shoulder appears at 75 nm<D<10075 nm𝐷10075\textrm{ nm}<D<10075 nm < italic_D < 100 nm for I=𝐼absentI=italic_I = 4 mM, which is unique compared to the spectra at other ionic strengths. This signifies a morphological change as two swollen brushes approach each other. As D𝐷Ditalic_D decreases, the brushes begin to overlap, which enhances the electrostatic repulsion and induces the collapse of proteins to reduce the local charge density. In this regime, the condensed proteins are sparsely distributed and each protein collapses individually. The force is thus nearly constant as reflected by the shoulder in the spectra. The “shoulder” signature in the force spectra can be illuminated by the end-block density distribution as shown in Fig. 8. For 75<D<10075𝐷10075<D<10075 < italic_D < 100 nm, the plateau in the region of 15 nm <z<30absent𝑧30<z<30< italic_z < 30 nm is almost maintained as D𝐷Ditalic_D decreases. There is a slight transfer of the density from the outer edge of the swollen layer to the inner condensed layer, indicating the independent collapse of individual proteins. This signature is absent for brushes at I𝐼absentI\geqitalic_I ≥ 6 mM, as the condensed layers are dense enough such that subsequent collapses of proteins cause progressively stronger energy penalties. Therefore, while reflectivity is sensitive to the condensed morphology, force spectroscopy is an effective tool for detecting the swollen morphology.

Refer to caption
Figure 8: Representative end-block distributions of one of the two opposing brushes at I=4𝐼4I=4italic_I = 4 mM. Distributions are labelled with their corresponding separation distances D𝐷Ditalic_D. The regime 75<D<10075𝐷10075<D<10075 < italic_D < 100 nm corresponds to the shoulder signature in the force spectra in Fig. 7.

As shown in Fig. 7, p𝑝pitalic_p drops discontinuously to a negative value at short separations for all I𝐼Iitalic_I. This is caused by the competition between the electrostatic repulsion dominant at large D𝐷Ditalic_D and the hydrophobic attraction between opposing brushes which dominates at small D𝐷Ditalic_D. At a critical D𝐷Ditalic_D, the two separated condensed layers from both brushes merge into a single condensed layer that occupies the entire space between the two substrates. As I𝐼Iitalic_I decreases, the electrostatic repulsion is less screened, which leads to a shift of the transition to smaller D𝐷Ditalic_D and a deeper attractive well. It is worth noting that the brush morphology and interaction is significantly affected by the dielectric inhomogeneity of the system, particularly at small separation distances. Furthermore, at very small separations, the excluded volume effect as a result of incompressibility and chain packing will play a significant role, where the pressure will rapidly increase and eventually become positive. Our work thus elucidates the non-trivial mechanical response and the corresponding morphological change between interacting brushes.

4 Conclusions

In this work, we have applied a continuous-space self-consistent field theory to study the morphological response of a neurofilament-derived protein brush to ionic strength. A coarse-graining approach based on a multi-block charged macromolecular model has been developed to capture the chemical identity of the amino acid sequence. For varying ionic strengths, the height of NFH brushes at pH 2.4 predicted by our theory is in good agreement with the experimental data reported in the literature. NFH brushes exhibit three distinct morphological regimes: swollen brushes at low I𝐼Iitalic_I, condensed brushes at high I𝐼Iitalic_I, and coexisting brushes at intermediate I𝐼Iitalic_I which contain a dense inner layer and a diffuse outer layer. Our theory enables the study of brush microstructure in terms of density distributions of constituent residues. We find that the dramatic height change observed in experiments originates from the transition between the overlapping state and the isolated state in the outer layer of the coexisting brushes induced by electrostatic screening. The evolution of the scattering behavior and mechanical property accompanying the morphological change has also been investigated. The appearance of the oscillatory signature in reflectivity spectra characterizes the existence of the condensed inner layer. Both the periodicity and the amplitude of the oscillations increase as I𝐼Iitalic_I increases, signifying thinner condensed layers with sharper interfaces. Furthermore, the force spectra between two opposing swollen brushes shows a signature of a shoulder due to the independent collapses of individual proteins. Our results demonstrate that reflectivity spectroscopy is sensitive to brushes with condensed layers and force spectroscopy is an effective tool for detecting the microstructure of brushes with swollen morphology.

Although the current work focuses on NFH brushes at pH 2.4, our theory can be straightforwardly generalized to brushes with any amino acid sequence, which facilitates the study of the effect of genetic and chemical modifications, such as phosphorylation. Our theory can also incorporate an explicit treatment of local proton concentration. The current work focuses on the comparison with experimental data measured at low pH (pH = 2.4). Under this condition of high proton concentration, the difference between the local and bulk proton concentrations can be neglected. However, at high pH, the local proton concentration can be significantly different from the bulk value, which necessitates an explicit treatment of local proton exchange 69. This treatment is important to accurately capture the response of brushes to external pH stimuli, particularly for proteins consisting of weak acid/base residues. We can also apply the theory to model brushes comprised of a mixture of different proteins to better represent neurofilaments. Lastly, the calculation can be performed at high dimensions to investigate brush patterning parallel to the substrate and interactions between two cylindrical brushes. Our theory provides a high-throughput computational platform which bridges the chemical structure of protein brushes and their morphological, scattering, and mechanical responses. This is important for the fundamental understanding of neurofilaments in axonal physiology, which plays a key role in the rational design of both stimuli-sensitive biomaterials and therapies for neurodegenerative diseases.

{acknowledgement}

This material is based upon work supported by the National Science Foundation Graduate Research Fellowship under Grant No. DGE 2146752 to TJY and EAD. This research used the computational resource provided by the Kenneth S. Pitzer Center for Theoretical Chemistry. The work was also supported by NIH R01GM122375 to SK.

{suppinfo}

NFH sequence and model parameters for amino acids; Derivation of self-consistent field theory for protein brushes; Sensitivity analysis of the coarse-graining procedure; Ionic density profiles near the substrate.

References

  • Yuan et al. 2017 Yuan, A.; Rao, M. V.; Veeranna; Nixon, R. A. Neurofilaments and Neurofilament Proteins in Health and Disease. Cold Spring Harbor Perspect. Biol. 2017, 9, a018309.
  • Zhu et al. 1997 Zhu, Q.; Couillard-Després, S.; Julien, J.-P. Delayed Maturation of Regenerating Myelinated Axons in Mice Lacking Neurofilaments. Exp. Neurol. 1997, 148, 299–316.
  • Yuan et al. 2012 Yuan, A.; Rao, M. V.;  , V.; Nixon, R. A. Neurofilaments at a glance. J. Cell Sci. 2012, 125, 3257–3263.
  • Barro et al. 2020 Barro, C.; Chitnis, T.; Weiner, H. L. Blood neurofilament light: a critical review of its application to neurologic disease. Ann. Clin. Transl. Neurol. 2020, 7, 2508–2523.
  • Lavedan et al. 2002 Lavedan, C.; Buchholtz, S.; Nussbaum, R. L.; Albin, R. L.; Polymeropoulos, M. H. A mutation in the human neurofilament M gene in Parkinson’s disease that suggests a role for the cytoskeleton in neuronal degeneration. Neurosci. Lett. 2002, 322, 57–61.
  • Langer and Tirrell 2004 Langer, R.; Tirrell, D. A. Designing materials for biology and medicine. Nature 2004, 428, 487–492.
  • Pan et al. 2020 Pan, F.; Aaron Lau, K. H.; Messersmith, P. B.; Lu, J. R.; Zhao, X. Interfacial Assembly Inspired by Marine Mussels and Antifouling Effects of Polypeptoids: A Neutron Reflection Study. Langmuir 2020, 36, 12309–12318.
  • Das et al. 2015 Das, S.; Banik, M.; Chen, G.; Sinha, S.; Mukherjee, R. Polyelectrolyte brushes: theory, modelling, synthesis and applications. Soft Matter 2015, 11, 8550–8583.
  • Conrad and Robertson 2019 Conrad, J. C.; Robertson, M. L. Towards mimicking biological function with responsive surface-grafted polymer brushes. Curr. Opin. Solid State Mater. Sci. 2019, 23, 1–12.
  • Blum et al. 2022 Blum, A. P.; Yin, J.; Lin, H. H.; Oliver, B. A.; Kammeyer, J. K.; Thompson, M. P.; Gilson, M. K.; Gianneschi, N. C. Stimuli Induced Uptake of Protein-Like Peptide Brush Polymers. Chem. - Eur. J. 2022, 28, e202103438.
  • Wiarachai et al. 2016 Wiarachai, O.; Vilaivan, T.; Iwasaki, Y.; Hoven, V. P. Clickable and Antifouling Platform of Poly[(propargyl methacrylate)-ran-(2-methacryloyloxyethyl phosphorylcholine)] for Biosensing Applications. Langmuir 2016, 32, 1184–1194.
  • Xie et al. 2015 Xie, G.; Tian, W.; Wen, L.; Xiao, K.; Zhang, Z.; Liu, Q.; Hou, G.; Li, P.; Tian, Y.; Jiang, L. Chiral recognition of l -tryptophan with beta-cyclodextrin-modified biomimetic single nanochannel. Chem. Commun. 2015, 51, 3135–3138.
  • Welch et al. 2011 Welch, M.; Rastogi, A.; Ober, C. Polymer brushes for electrochemical biosensors. Soft Matter 2011, 7, 297–302.
  • Ito and Soon Park 2000 Ito, Y.; Soon Park, Y. Signal-responsive gating of porous membranes by polymer brushes. Polym. Adv. Technol. 2000, 11, 136–144.
  • Yameen et al. 2009 Yameen, B.; Ali, M.; Neumann, R.; Ensinger, W.; Knoll, W.; Azzaroni, O. Single Conical Nanopores Displaying pH-Tunable Rectifying Characteristics. Manipulating Ionic Transport With Zwitterionic Polymer Brushes. J. Am. Chem. Soc. 2009, 131, 2070–2071.
  • Kelby et al. 2011 Kelby, T. S.; Wang, M.; Huck, W. T. Controlled Folding of 2D Au–Polymer Brush Composites into 3D Microstructures. Adv. Funct. Mater. 2011, 21, 652–657.
  • Ionov et al. 2006 Ionov, L.; Stamm, M.; Diez, S. Reversible Switching of Microtubule Motility Using Thermoresponsive Polymer Surfaces. Nano Lett. 2006, 6, 1982–1987.
  • Kobayashi and Takahara 2010 Kobayashi, M.; Takahara, A. Tribological properties of hydrophilic polymer brushes under wet conditions. Chem. Rec. 2010, 10, 208–216.
  • Liechty et al. 2010 Liechty, W. B.; Kryscio, D. R.; Slaughter, B. V.; Peppas, N. A. Polymers for Drug Delivery Systems. Annu. Rev. Chem. Biomol. Eng. 2010, 1, 149–173.
  • Srinivasan et al. 2014 Srinivasan, N.; Bhagawati, M.; Ananthanarayanan, B.; Kumar, S. Stimuli-sensitive intrinsically disordered protein brushes. Nat. Commun. 2014, 5, 5145.
  • Israels et al. 1994 Israels, R.; Leermakers, F. A. M.; Fleer, G. J.; Zhulina, E. B. Charged Polymeric Brushes: Structure and Scaling Relations. Macromolecules 1994, 27, 3249–3261.
  • Chen et al. 2017 Chen, W.-L.; Cordero, R.; Tran, H.; Ober, C. K. 50th Anniversary Perspective: Polymer Brushes: Novel Surfaces for Future Materials. Macromolecules 2017, 50, 4089–4113.
  • Fuchs and Cleveland 1998 Fuchs, E.; Cleveland, D. W. A Structural Scaffolding of Intermediate Filaments in Health and Disease. Science 1998, 279, 514–519.
  • Zhulina and Leermakers 2010 Zhulina, E.; Leermakers, F. The Polymer Brush Model of Neurofilament Projections: Effect of Protein Composition. Biophys. J. 2010, 98, 462–469.
  • Elder et al. 1998 Elder, G. A.; Friedrich, V. L., Jr.; Kang, C.; Bosco, P.; Gourov, A.; Tu, P.-H.; Zhang, B.; Lee, V. M.-Y.; Lazzarini, R. A. Requirement of Heavy Neurofilament Subunit in the Development of Axons with Large Calibers. J. Cell Biol. 1998, 143, 195–205.
  • Zhu et al. 1998 Zhu, Q.; Lindenbaum, M.; Levavasseur, F.; Jacomy, H.; Julien, J.-P. Disruption of the NF-H Gene Increases Axonal Microtubule Content and Velocity of Neurofilament Transport: Relief of Axonopathy Resulting from the Toxin Beta,Beta’-Iminodipropionitrile. J. Cell Biol. 1998, 143, 183–193.
  • Rao et al. 1998 Rao, M. V.; Houseweart, M. K.; Williamson, T. L.; Crawford, T. O.; Folmer, J.; Cleveland, D. W. Neurofilament-dependent Radial Growth of Motor Axons and Axonal Organization of Neurofilaments Does Not Require the Neurofilament Heavy Subunit (NF-H) or Its Phosphorylation. J. Cell Biol. 1998, 143, 171–181.
  • Bhagawati et al. 2016 Bhagawati, M.; Rubashkin, M. G.; Lee, J. P.; Ananthanarayanan, B.; Weaver, V. M.; Kumar, S. Site-Specific Modulation of Charge Controls the Structure and Stimulus Responsiveness of Intrinsically Disordered Peptide Brushes. Langmuir 2016, 32, 5990–5996.
  • Lei et al. 2018 Lei, R.; Lee, J. P.; Francis, M. B.; Kumar, S. Structural Regulation of a Neurofilament-Inspired Intrinsically Disordered Protein Brush by Multisite Phosphorylation. Biochemistry 2018, 57, 4019–4028.
  • Hest and A. Tirrell 2001 Hest, J. C. M. v.; A. Tirrell, D. Protein-based materials, toward a new level of structural control. Chem. Commun. 2001, 0, 1897–1904.
  • Alexander 1977 Alexander, S. Adsorption of chain molecules with a polar head a scaling description. J. Phys. (Paris) 1977, 38, 983–987.
  • de Gennes 1980 de Gennes, P.-G. Conformations of Polymers Attached to an Interface. Macromolecules 1980, 13, 1069–1075.
  • Milner et al. 1988 Milner, S. T.; Witten, T. A.; Cates, M. E. Theory of the grafted polymer brush. Macromolecules 1988, 21, 2610–2619.
  • Milner, S. T. 1991 Milner, S. T. Polymer Brushes. Science 1991, 251, 905–914.
  • Skvortsov et al. 1988 Skvortsov, A. M.; Pavlushkov, I. V.; Gorbunov, A. A.; Zhulina, Y. B.; Borisov, O. V.; Pryamitsyn, V. A. Structure of densely grafted polymeric monolayers. Polym. Sci. U.S.S.R. 1988, 30, 1706–1715.
  • Wijmans et al. 1992 Wijmans, C. M.; Scheutjens, J. M. H. M.; Zhulina, E. B. Self-consistent field theories for polymer brushes: lattice calculations and an asymptotic analytical description. Macromolecules 1992, 25, 2657–2665.
  • Scheutjens and Fleer 1979 Scheutjens, J. M. H. M.; Fleer, G. J. Statistical theory of the adsorption of interacting chain molecules. 1. Partition function, segment density distribution, and adsorption isotherms. J. Phys. Chem. 1979, 83, 1619–1635.
  • Scheutjens and Fleer 1980 Scheutjens, J. M. H. M.; Fleer, G. J. Statistical theory of the adsorption of interacting chain molecules. 2. Train, loop, and tail size distribution. J. Phys. Chem. 1980, 84, 178–190.
  • Leermakers et al. 2010 Leermakers, F. A. M.; Jho, Y.-S.; Zhulina, E. B. Modeling of the 3RS tau protein with self-consistent field method and Monte Carlo simulation. Soft Matter 2010, 6, 5533–5540.
  • Zhulina and Leermakers 2007 Zhulina, E. B.; Leermakers, F. A. M. Effect of the Ionic Strength and pH on the Equilibrium Structure of a Neurofilament Brush. Biophys. J. 2007, 93, 1452–1463.
  • Zhulina and Leermakers 2007 Zhulina, E.; Leermakers, F. A Self-Consistent Field Analysis of the Neurofilament Brush with Amino-Acid Resolution. Biophys. J. 2007, 93, 1421–1430.
  • Bianchi et al. 2020 Bianchi, G.; Longhi, S.; Grandori, R.; Brocca, S. Relevance of Electrostatic Charges in Compactness, Aggregation, and Phase Separation of Intrinsically Disordered Proteins. Int. J. Mol. Sci. 2020, 21, 6208.
  • Lee et al. 2013 Lee, J.; Kim, S.; Chang, R.; Jayanthi, L.; Gebremichael, Y. Effects of molecular model, ionic strength, divalent ions, and hydrophobic interaction on human neurofilament conformation. J. Chem. Phys. 2013, 138, 015103.
  • Choi et al. 2020 Choi, J.-M.; Holehouse, A. S.; Pappu, R. V. Physical Principles Underlying the Complex Biology of Intracellular Phase Transitions. Annu. Rev. Biophys. 2020, 49, 107–133.
  • Dietz and Rief 2006 Dietz, H.; Rief, M. Protein structure by mechanical triangulation. Proc. Natl. Acad. Sci. U. S. A. 2006, 103, 1244–1247.
  • Oesterhelt et al. 2000 Oesterhelt, F.; Oesterhelt, D.; Pfeiffer, M.; Engel, A.; Gaub, H. E.; Müller, D. J. Unfolding Pathways of Individual Bacteriorhodopsins. Science 2000, 288, 143–146.
  • Lide 1991 Lide, D. R. CRC Handbook of Chemistry and Physics, 72nd ed.; CRC Press: Boca Raton, FL, 1991.
  • Fredrickson 2006 Fredrickson, G. H. The equilibrium theory of inhomogeneous polymers; International series of monographs on physics 134; Clarendon Press; Oxford University Press: Oxford : New York, 2006.
  • Duan et al. 2020 Duan, C.; Li, W.; Wang, R. Conformation of a single polyelectrolyte in poor solvents. J. Chem. Phys. 2020, 153, 064901.
  • Duan and Wang 2022 Duan, C.; Wang, R. Association of two polyelectrolytes in salt solutions. Soft Matter 2022, 18, 6934–6941.
  • Duan et al. 2022 Duan, C.; Li, W.; Wang, R. Stable Vesicles Formed by a Single Polyelectrolyte in Salt Solutions. Macromolecules 2022, 55, 906–913.
  • Duan and Wang 2023 Duan, C.; Wang, R. Electrostatics-Induced Nucleated Conformational Transition of Protein Aggregation. Phys. Rev. Lett. 2023, 130, 158401.
  • Israelachvili 2011 Israelachvili, J. N. Intermolecular and Surface Forces, 3rd ed.; Elsevier Academic Press: San Diego, CA, 2011.
  • Wang and Wang 2014 Wang, R.; Wang, Z.-G. Theory of Polymer Chains in Poor Solvent: Single-Chain Structure, Solution Thermodynamics, and Theta Point. Macromolecules 2014, 47, 4094–4102.
  • Chantawansri et al. 2011 Chantawansri, T. L.; Hur, S.-M.; García-Cervera, C. J.; Ceniceros, H. D.; Fredrickson, G. H. Spectral collocation methods for polymer brushes. J. Chem. Phys. 2011, 134, 244905.
  • Hoffman and Frankel 2018 Hoffman, J. D.; Frankel, S. Numerical Methods for Engineers and Scientists; CRC Press, 2018.
  • Klushin et al. 2001 Klushin, L. I.; Birshtein, T. M.; Amoskov, V. M. Microphase Coexistence in Brushes. Macromolecules 2001, 34, 9156–9167.
  • Ballauff and Borisov 2016 Ballauff, M.; Borisov, O. Phase transitions in Homopolymers. Polymer 2016, 402–408.
  • Borisov et al. 1994 Borisov, O. V.; Zhulina, E. B.; Birshtein, T. M. Diagram of the States of a Grafted Polyelectrolyte Layer. Macromolecules 1994, 27, 4795–4803.
  • Skoda 2019 Skoda, M. W. A. Recent developments in the application of X-ray and neutron reflectivity to soft-matter systems. Curr. Opin. Colloid Interface Sci. 2019, 42, 41–54.
  • Xu et al. 2013 Xu, H.; Penfold, J.; Thomas, R. K.; Petkov, J. T.; Tucker, I.; Webster, J. P. R. The Formation of Surface Multilayers at the Air–Water Interface from Sodium Polyethylene Glycol Monoalkyl Ether Sulfate/AlCl3 Solutions: The Role of the Size of the Polyethylene Oxide Group. Langmuir 2013, 29, 11656–11666.
  • Russell 1990 Russell, T. P. X-ray and neutron reflectivity for the investigation of polymers. Mater. Sci. Rep. 1990, 5, 171–271.
  • Braslau et al. 1985 Braslau, A.; Deutsch, M.; Pershan, P. S.; Weiss, A. H.; Als-Nielsen, J.; Bohr, J. Surface Roughness of Water Measured by X-Ray Reflectivity. Phys. Rev. Lett. 1985, 54, 4.
  • Reinhardt et al. 2013 Reinhardt, M.; Dzubiella, J.; Trapp, M.; Gutfreund, P.; Kreuzer, M.; Gröschel, A. H.; Müller, A. H. E.; Ballauff, M.; Steitz, R. Fine-Tuning the Structure of Stimuli-Responsive Polymer Films by Hydrostatic Pressure and Temperature. Macromolecules 2013, 46, 6541–6547.
  • Laloyaux et al. 2010 Laloyaux, X.; Mathy, B.; Nysten, B.; Jonas, A. M. Surface and Bulk Collapse Transitions of Thermoresponsive Polymer Brushes. Langmuir 2010, 26, 838–847.
  • Yim et al. 2005 Yim, H.; Kent, M. S.; Satija, S.; Mendez, S.; Balamurugan, S. S.; Balamurugan, S.; Lopez, G. P. Evidence for vertical phase separation in densely grafted, high-molecular-weight poly(N-isopropylacrylamide) brushes in water. Phys. Rev. E 2005, 72, 051801.
  • Balastre et al. 2002 Balastre, M.; Li, F.; Schorr, P.; Yang, J.; Mays, J. W.; Tirrell, M. V. A Study of Polyelectrolyte Brushes Formed from Adsorption of Amphiphilic Diblock Copolymers Using the Surface Forces Apparatus. Macromolecules 2002, 35, 9480–9486.
  • Drobek et al. 2005 Drobek, T.; Spencer, N. D.; Heuberger, M. Compressing PEG Brushes. Macromolecules 2005, 38, 5254–5259.
  • Balzer and Wang 2023 Balzer, C.; Wang, Z.-G. Electroresponse of weak polyelectrolyte brushes. Eur. Phys. J. E: Soft Matter Biol. Phys. 2023, 46, 82.

Supplemental Information


4.1 I. NFH Sequence and Model Parameters for Amino Acids

In this section, the amino acid sequence of NFH and the amino acid parameters used in this work are provided.

The NFH sequence was obtained from the authors of Srinivasan et al. 20: \seqsplitMGCWYMSEFTSMSTHIKVKSEEKIKVVEKSEKETVIVEEQTEEIQVTEEVTEEEDKEAQGEEEEEAEEGGEEAATTSPPA EEAASPEKETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPAEVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPAEVKSPATVKSPG EAKSPAEAKSPAEVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSPAEVKSPVTVKSPAEAKSPVEVKSP ASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPEKAKSPVKEG AKSLAEAKSPEKAKSPVKEEIKPPAEVKSPEKAKSPMKEEAKSPEKAKTLDVKSPEAKTPAKEEAKRPADIRSPEQVKSPAKEEAKSP EKEETRTEKVAPKKEEVKSPVEEVKAKEPPKKVEEEKTPATPKTEVKESKKDEAPKEAQKPKAEEKEPLTEKPKDSPGEAK KEEAKEKKAAAPEEETPAKLGVKEEAKPKEKAEDAKAKEPSKPSEKEKPKKEEVPAAPEKKDTKEEKTTESKKPEEKPKME AKAKEEDKGLPQEPSKPKTEKAEKSSSTDQKDSQPSEKAPEDKLLEHHHHHH

The interaction parameter χisubscript𝜒𝑖\chi_{i}italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT between block i𝑖iitalic_i and solvent are calculated by the average of the interaction parameters of its constituent amino acids. The interaction parameters between amino acids and solvent are based on groups and values previously used in the literature 40, 43:

{G, P, C, M, A, L, V, I} = 4.0

{Y, Q, N, H, F, W, S, T} = 0.6

{E, D, K, R} = 0.0


The charge on each amino acid at the bulk pH is calculated using the Henderson–Hasselbalch equation and the dissociation constants for acidic and basic residues 47:

pKasubscriptpKa\mathrm{pK_{a}}roman_pK start_POSTSUBSCRIPT roman_a end_POSTSUBSCRIPT:

D: 3.65, E: 4.25

pKbsubscriptpKb\mathrm{pK_{b}}roman_pK start_POSTSUBSCRIPT roman_b end_POSTSUBSCRIPT:

H: 6.00, K: 10.53, R: 12.48, C: 8.18, Y: 10.07

4.2 II. Derivation of Self-consistent Field Theory for Protein Brushes

In this section, a detailed derivation of the key equations in the SCFT for the multiblock macromolecular model used for protein brushes is provided. In Subsection II.1, the derivation for proteins with quenched charge is provided, which is directly calculated from bulk pH. In Subsection II.2, an annealed model is adopted for the protein charge, which explicitly considers the local proton concentration.

4.2.1 II.1. Quenched Charge Model for Proteins

The particle-based partition function and Hamiltonian are given in Eqs. 1 and 2 of the main text. The transform from particle-based to field-based representation is conducted through the identity transform:

1=𝒟ϕk𝐫δ[ϕk(𝐫)ϕ^k(𝐫)]=𝒟ϕk𝒟wkexp{id𝐫wk(𝐫)[ϕk(𝐫)ϕ^k(𝐫)]}k=(i,s)formulae-sequence1𝒟subscriptitalic-ϕ𝑘subscriptproduct𝐫𝛿delimited-[]subscriptitalic-ϕ𝑘𝐫subscript^italic-ϕ𝑘𝐫𝒟subscriptitalic-ϕ𝑘𝒟subscript𝑤𝑘𝑖differential-d𝐫subscript𝑤𝑘𝐫delimited-[]subscriptitalic-ϕ𝑘𝐫subscript^italic-ϕ𝑘𝐫𝑘𝑖𝑠1=\int\mathcal{D}\phi_{k}\ \prod_{\mathbf{r}}\delta\big{[}\phi_{k}(\mathbf{r})% -\hat{\phi}_{k}(\mathbf{r})\big{]}=\int\mathcal{D}\phi_{k}\mathcal{D}w_{k}\exp% \bigg{\{}i\int\mathrm{d}\mathbf{r}\ w_{k}(\mathbf{r})\big{[}\phi_{k}(\mathbf{r% })-\hat{\phi}_{k}(\mathbf{r})\big{]}\bigg{\}}\quad k=(i,s)\\ 1 = ∫ caligraphic_D italic_ϕ start_POSTSUBSCRIPT italic_k end_POSTSUBSCRIPT ∏ start_POSTSUBSCRIPT bold_r end_POSTSUBSCRIPT italic_δ [ italic_ϕ start_POSTSUBSCRIPT italic_k end_POSTSUBSCRIPT ( bold_r ) - over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_k end_POSTSUBSCRIPT ( bold_r ) ] = ∫ caligraphic_D italic_ϕ start_POSTSUBSCRIPT italic_k end_POSTSUBSCRIPT caligraphic_D italic_w start_POSTSUBSCRIPT italic_k end_POSTSUBSCRIPT roman_exp { italic_i ∫ roman_d bold_r italic_w start_POSTSUBSCRIPT italic_k end_POSTSUBSCRIPT ( bold_r ) [ italic_ϕ start_POSTSUBSCRIPT italic_k end_POSTSUBSCRIPT ( bold_r ) - over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_k end_POSTSUBSCRIPT ( bold_r ) ] } italic_k = ( italic_i , italic_s ) (S1)

These transforms introduce the Fourier conjugate fields wisubscript𝑤𝑖w_{i}italic_w start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT and wssubscript𝑤𝑠w_{s}italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT for each protein block i𝑖iitalic_i and solvent, respectively. The Fourier representation of the incompressibility condition is

1=𝒟η𝐫δ[1i=1ξϕ^i(𝐫)ϕ^s(𝐫)]=𝒟ηexp{id𝐫η(𝐫)[1i=1ξϕ^i(𝐫)ϕ^s(𝐫)]}1𝒟𝜂subscriptproduct𝐫𝛿delimited-[]1superscriptsubscript𝑖1𝜉subscript^italic-ϕ𝑖𝐫subscript^italic-ϕ𝑠𝐫𝒟𝜂𝑖differential-d𝐫𝜂𝐫delimited-[]1superscriptsubscript𝑖1𝜉subscript^italic-ϕ𝑖𝐫subscript^italic-ϕ𝑠𝐫1=\int\mathcal{D}\eta\ \prod_{\mathbf{r}}\delta\bigg{[}1-\sum_{i=1}^{\xi}\hat{% \phi}_{i}(\mathbf{r})-\hat{\phi}_{s}(\mathbf{r})\bigg{]}=\int\mathcal{D}\eta% \exp\bigg{\{}i\int\mathrm{d}\mathbf{r}\ \eta(\mathbf{r})\bigg{[}1-\sum_{i=1}^{% \xi}\hat{\phi}_{i}(\mathbf{r})-\hat{\phi}_{s}(\mathbf{r})\bigg{]}\bigg{\}}1 = ∫ caligraphic_D italic_η ∏ start_POSTSUBSCRIPT bold_r end_POSTSUBSCRIPT italic_δ [ 1 - ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( bold_r ) - over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( bold_r ) ] = ∫ caligraphic_D italic_η roman_exp { italic_i ∫ roman_d bold_r italic_η ( bold_r ) [ 1 - ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( bold_r ) - over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( bold_r ) ] } (S2)

where η𝜂\etaitalic_η is the conjugate field. Substituting Eqs. S1 and S2 into the partition function yields:

Ξ=i=1ξ𝒟ϕi𝒟wi𝒟ϕs𝒟ws𝒟η1np!νNnpγnγ=0eμγnγnγ!νγnγj=1nγd𝐫γ,jk=1np𝒟{𝐑k}exp{32b20Nds(𝐑k(s)s)2}exp{1νd𝐫i=1ξ(χiϕiϕs+jiξχij2ϕiϕj)βe22d𝐫d𝐫ρ^c(𝐫)C(𝐫,𝐫)ρ^c(𝐫)}exp{1νd𝐫[iη(i=1ξϕi+ϕs1)+ii=1ξ(wi(ϕiϕ^i))+iws(ϕsϕ^s)]}(γ=s,±)Ξsuperscriptsubscriptproduct𝑖1𝜉𝒟subscriptitalic-ϕ𝑖𝒟subscript𝑤𝑖𝒟subscriptitalic-ϕ𝑠𝒟subscript𝑤𝑠𝒟𝜂1subscript𝑛𝑝superscript𝜈𝑁subscript𝑛𝑝subscriptproduct𝛾superscriptsubscriptsubscript𝑛𝛾0superscript𝑒subscript𝜇𝛾subscript𝑛𝛾subscript𝑛𝛾superscriptsubscript𝜈𝛾subscript𝑛𝛾superscriptsubscriptproduct𝑗1subscript𝑛𝛾dsubscript𝐫𝛾𝑗superscriptsubscriptproduct𝑘1subscript𝑛𝑝𝒟subscript𝐑𝑘32superscript𝑏2superscriptsubscript0𝑁dssuperscriptsubscript𝐑𝑘ss21𝜈differential-d𝐫superscriptsubscript𝑖1𝜉subscript𝜒𝑖subscriptitalic-ϕ𝑖subscriptitalic-ϕ𝑠superscriptsubscript𝑗𝑖𝜉subscript𝜒𝑖𝑗2subscriptitalic-ϕ𝑖subscriptitalic-ϕ𝑗𝛽superscript𝑒22differential-d𝐫differential-dsuperscript𝐫subscript^𝜌𝑐𝐫𝐶𝐫superscript𝐫subscript^𝜌𝑐superscript𝐫1𝜈differential-d𝐫delimited-[]𝑖𝜂superscriptsubscript𝑖1𝜉subscriptitalic-ϕ𝑖subscriptitalic-ϕ𝑠1𝑖superscriptsubscript𝑖1𝜉subscript𝑤𝑖subscriptitalic-ϕ𝑖subscript^italic-ϕ𝑖𝑖subscript𝑤𝑠subscriptitalic-ϕ𝑠subscript^italic-ϕ𝑠𝛾𝑠plus-or-minus\begin{split}\Xi=&\int\prod_{i=1}^{\xi}\mathcal{D}\phi_{i}\mathcal{D}w_{i}% \mathcal{D}\phi_{s}\mathcal{D}w_{s}\mathcal{D}\eta\ \frac{1}{n_{p}!\nu^{Nn_{p}% }}\prod_{\gamma}\sum_{n_{\gamma}=0}^{\infty}\frac{e^{\mu_{\gamma}n_{\gamma}}}{% n_{\gamma}!\nu_{\gamma}^{n_{\gamma}}}\\ &\int\prod_{j=1}^{n_{\gamma}}\mathrm{d}\mathbf{r}_{\gamma,j}\ \int\prod_{k=1}^% {n_{p}}\mathcal{D}\{\mathbf{R}_{k}\}\ \exp\bigg{\{}-\frac{3}{2b^{2}}\int_{0}^{% N}\mathrm{ds}\ \bigg{(}\frac{\partial\mathbf{R}_{k}(\textrm{s})}{\partial% \textrm{s}}\bigg{)}^{2}\bigg{\}}\\ &\exp\bigg{\{}-\frac{1}{\nu}\int\mathrm{d}\mathbf{r}\ \sum_{i=1}^{\xi}\bigg{(}% \chi_{i}\phi_{i}\phi_{s}+\sum_{j\neq i}^{\xi}\frac{\chi_{ij}}{2}\phi_{i}\phi_{% j}\bigg{)}-\frac{\beta e^{2}}{2}\int\mathrm{d}\mathbf{r}\ \mathrm{d}\mathbf{r}% ^{\prime}\ \hat{\rho}_{c}(\mathbf{r})\ C(\mathbf{r},\mathbf{r}^{\prime})\ \hat% {\rho}_{c}(\mathbf{r}^{\prime})\bigg{\}}\\ &\exp\bigg{\{}\frac{1}{\nu}\int\mathrm{d}\mathbf{r}\ \bigg{[}i\eta\big{(}\sum_% {i=1}^{\xi}\phi_{i}+\phi_{s}-1\big{)}+i\sum_{i=1}^{\xi}\big{(}w_{i}\big{(}\phi% _{i}-\hat{\phi}_{i}\big{)}\big{)}+iw_{s}\big{(}\phi_{s}-\hat{\phi}_{s}\big{)}% \bigg{]}\bigg{\}}~{}~{}(\gamma=s,\pm)\end{split}start_ROW start_CELL roman_Ξ = end_CELL start_CELL ∫ ∏ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT caligraphic_D italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT caligraphic_D italic_w start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT caligraphic_D italic_ϕ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT caligraphic_D italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT caligraphic_D italic_η divide start_ARG 1 end_ARG start_ARG italic_n start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ! italic_ν start_POSTSUPERSCRIPT italic_N italic_n start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT end_POSTSUPERSCRIPT end_ARG ∏ start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT ∑ start_POSTSUBSCRIPT italic_n start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT = 0 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT ∞ end_POSTSUPERSCRIPT divide start_ARG italic_e start_POSTSUPERSCRIPT italic_μ start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT italic_n start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT end_POSTSUPERSCRIPT end_ARG start_ARG italic_n start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT ! italic_ν start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_n start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT end_POSTSUPERSCRIPT end_ARG end_CELL end_ROW start_ROW start_CELL end_CELL start_CELL ∫ ∏ start_POSTSUBSCRIPT italic_j = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_n start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT end_POSTSUPERSCRIPT roman_d bold_r start_POSTSUBSCRIPT italic_γ , italic_j end_POSTSUBSCRIPT ∫ ∏ start_POSTSUBSCRIPT italic_k = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_n start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT end_POSTSUPERSCRIPT caligraphic_D { bold_R start_POSTSUBSCRIPT italic_k end_POSTSUBSCRIPT } roman_exp { - divide start_ARG 3 end_ARG start_ARG 2 italic_b start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT end_ARG ∫ start_POSTSUBSCRIPT 0 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_N end_POSTSUPERSCRIPT roman_ds ( divide start_ARG ∂ bold_R start_POSTSUBSCRIPT italic_k end_POSTSUBSCRIPT ( s ) end_ARG start_ARG ∂ s end_ARG ) start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT } end_CELL end_ROW start_ROW start_CELL end_CELL start_CELL roman_exp { - divide start_ARG 1 end_ARG start_ARG italic_ν end_ARG ∫ roman_d bold_r ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT ( italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT + ∑ start_POSTSUBSCRIPT italic_j ≠ italic_i end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT divide start_ARG italic_χ start_POSTSUBSCRIPT italic_i italic_j end_POSTSUBSCRIPT end_ARG start_ARG 2 end_ARG italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_j end_POSTSUBSCRIPT ) - divide start_ARG italic_β italic_e start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT end_ARG start_ARG 2 end_ARG ∫ roman_d bold_r roman_d bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT over^ start_ARG italic_ρ end_ARG start_POSTSUBSCRIPT italic_c end_POSTSUBSCRIPT ( bold_r ) italic_C ( bold_r , bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT ) over^ start_ARG italic_ρ end_ARG start_POSTSUBSCRIPT italic_c end_POSTSUBSCRIPT ( bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT ) } end_CELL end_ROW start_ROW start_CELL end_CELL start_CELL roman_exp { divide start_ARG 1 end_ARG start_ARG italic_ν end_ARG ∫ roman_d bold_r [ italic_i italic_η ( ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT + italic_ϕ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT - 1 ) + italic_i ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT ( italic_w start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT - over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ) ) + italic_i italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( italic_ϕ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT - over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ) ] } ( italic_γ = italic_s , ± ) end_CELL end_ROW (S3)

Note that we assume νp=νs=νsubscript𝜈𝑝subscript𝜈𝑠𝜈\nu_{p}=\nu_{s}=\nuitalic_ν start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT = italic_ν start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT = italic_ν.

By grouping polymer-specific and solvent-specific terms, we arrive at the single-particle solvent partition function Qssubscript𝑄𝑠Q_{s}italic_Q start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT and single-chain polymer partition function Qpsubscript𝑄𝑝Q_{p}italic_Q start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT:

Qs=1νd𝐫βexp(iws(𝐫β))Qp=1νN𝒟𝐑exp{0Nds[32b2(𝐑s)2iwi(𝐑)]}=1νd𝐫q(𝐫;N),subscript𝑄𝑠1𝜈differential-dsubscript𝐫𝛽𝑖subscript𝑤𝑠subscript𝐫𝛽subscript𝑄𝑝1superscript𝜈𝑁𝒟𝐑superscriptsubscript0𝑁dsdelimited-[]32superscript𝑏2superscript𝐑s2𝑖subscript𝑤𝑖𝐑1𝜈differential-d𝐫𝑞𝐫𝑁\begin{split}Q_{s}&=\frac{1}{\nu}\int\mathrm{d}\mathbf{r}_{\beta}\ \exp\big{(}% -iw_{s}(\mathbf{r}_{\beta})\big{)}\\ Q_{p}&=\frac{1}{\nu^{N}}\int\mathcal{D}\mathbf{R}\ \exp\left\{-\int_{0}^{N}% \mathrm{ds}\ \bigg{[}\frac{3}{2b^{2}}\bigg{(}\frac{\partial\mathbf{R}}{% \partial\mathrm{s}}\bigg{)}^{2}-iw_{i}(\mathbf{R})\bigg{]}\right\}\\ &=\frac{1}{\nu}\int\mathrm{d}\mathbf{r}\ q(\mathbf{r};N)\ ,\end{split}start_ROW start_CELL italic_Q start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT end_CELL start_CELL = divide start_ARG 1 end_ARG start_ARG italic_ν end_ARG ∫ roman_d bold_r start_POSTSUBSCRIPT italic_β end_POSTSUBSCRIPT roman_exp ( - italic_i italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( bold_r start_POSTSUBSCRIPT italic_β end_POSTSUBSCRIPT ) ) end_CELL end_ROW start_ROW start_CELL italic_Q start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT end_CELL start_CELL = divide start_ARG 1 end_ARG start_ARG italic_ν start_POSTSUPERSCRIPT italic_N end_POSTSUPERSCRIPT end_ARG ∫ caligraphic_D bold_R roman_exp { - ∫ start_POSTSUBSCRIPT 0 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_N end_POSTSUPERSCRIPT roman_ds [ divide start_ARG 3 end_ARG start_ARG 2 italic_b start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT end_ARG ( divide start_ARG ∂ bold_R end_ARG start_ARG ∂ roman_s end_ARG ) start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT - italic_i italic_w start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( bold_R ) ] } end_CELL end_ROW start_ROW start_CELL end_CELL start_CELL = divide start_ARG 1 end_ARG start_ARG italic_ν end_ARG ∫ roman_d bold_r italic_q ( bold_r ; italic_N ) , end_CELL end_ROW (S4)

where the propagator q(𝐫;s)𝑞𝐫sq(\mathbf{r};\mathrm{s})italic_q ( bold_r ; roman_s ) originating from the grafted end in the final line satisfies the modified diffusion equation (Eq. 4 in the main text)48 :

sq(𝐫;s)=b26𝑠𝑞𝐫ssuperscript𝑏26\displaystyle\frac{\partial}{\partial s}q(\mathbf{r};\mathrm{s})=\frac{b^{2}}{6}divide start_ARG ∂ end_ARG start_ARG ∂ italic_s end_ARG italic_q ( bold_r ; roman_s ) = divide start_ARG italic_b start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT end_ARG start_ARG 6 end_ARG 2q(𝐫;s)wi(𝐫)q(𝐫;s);,superscript2𝑞𝐫𝑠subscript𝑤𝑖𝐫𝑞𝐫𝑠\displaystyle\nabla^{2}q(\mathbf{r};s)-w_{i}(\mathbf{r})q(\mathbf{r};s);,∇ start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT italic_q ( bold_r ; italic_s ) - italic_w start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( bold_r ) italic_q ( bold_r ; italic_s ) ; , (S5)
wherewi(𝐫)wheresubscript𝑤𝑖𝐫\displaystyle\text{where}\;w_{i}(\mathbf{r})where italic_w start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( bold_r ) ={w1(𝐫)for s=[0,N1]wξ(𝐫)for s=[j=0ξ1Nj,j=0ξNj]absentcasessubscript𝑤1𝐫for 𝑠0subscript𝑁1otherwisesubscript𝑤𝜉𝐫for 𝑠superscriptsubscript𝑗0𝜉1subscript𝑁𝑗superscriptsubscript𝑗0𝜉subscript𝑁𝑗\displaystyle=\begin{cases}w_{1}(\mathbf{r})&\text{for }s=[0,N_{1}]\\ &\vdots\\ w_{\xi}(\mathbf{r})&\text{for }s=[\sum_{j=0}^{\xi-1}N_{j},\sum_{j=0}^{\xi}N_{j% }]\end{cases}= { start_ROW start_CELL italic_w start_POSTSUBSCRIPT 1 end_POSTSUBSCRIPT ( bold_r ) end_CELL start_CELL for italic_s = [ 0 , italic_N start_POSTSUBSCRIPT 1 end_POSTSUBSCRIPT ] end_CELL end_ROW start_ROW start_CELL end_CELL start_CELL ⋮ end_CELL end_ROW start_ROW start_CELL italic_w start_POSTSUBSCRIPT italic_ξ end_POSTSUBSCRIPT ( bold_r ) end_CELL start_CELL for italic_s = [ ∑ start_POSTSUBSCRIPT italic_j = 0 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ - 1 end_POSTSUPERSCRIPT italic_N start_POSTSUBSCRIPT italic_j end_POSTSUBSCRIPT , ∑ start_POSTSUBSCRIPT italic_j = 0 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT italic_N start_POSTSUBSCRIPT italic_j end_POSTSUBSCRIPT ] end_CELL end_ROW

The counter propagator qc(𝐫;s)subscript𝑞𝑐𝐫sq_{c}(\mathbf{r};\mathrm{s})italic_q start_POSTSUBSCRIPT italic_c end_POSTSUBSCRIPT ( bold_r ; roman_s ) originating from the free end also satisfies the modified diffusion equation. Finally, we perform the Hubbard–Stratonovich transformation to decouple the interactions between charged particles:

exp{β2d𝐫d𝐫ρ^c(𝐫)C(𝐫,𝐫)ρ^c(𝐫)}=Cψ𝒟ψexp{β2d𝐫d𝐫ψ(𝐫)C1(𝐫,𝐫)ψ(𝐫)iβd𝐫ρ^c(𝐫)ψ(𝐫)}=Cψ𝒟ψexp{d𝐫[ϵ(𝐫)2|iψ(𝐫)|2ρ^ciψ(𝐫)]},𝛽2d𝐫dsuperscript𝐫subscript^𝜌𝑐𝐫𝐶𝐫superscript𝐫subscript^𝜌𝑐superscript𝐫subscript𝐶𝜓𝒟𝜓𝛽2differential-d𝐫differential-dsuperscript𝐫𝜓𝐫superscript𝐶1𝐫superscript𝐫𝜓superscript𝐫𝑖𝛽differential-d𝐫subscript^𝜌𝑐𝐫𝜓𝐫subscript𝐶𝜓𝒟𝜓differential-d𝐫delimited-[]italic-ϵ𝐫2superscript𝑖𝜓𝐫2subscript^𝜌𝑐𝑖𝜓𝐫\begin{split}\exp\bigg{\{}-\frac{\beta}{2}&\int\mathrm{d}\mathbf{r}\mathrm{d}% \mathbf{r}^{\prime}\ \hat{\rho}_{c}(\mathbf{r})C(\mathbf{r},\mathbf{r}^{\prime% })\hat{\rho}_{c}(\mathbf{r}^{\prime})\bigg{\}}\\ &=C_{\psi}\int\mathcal{D}\psi\ \exp\bigg{\{}-\frac{\beta}{2}\int\mathrm{d}% \mathbf{r}\mathrm{d}\mathbf{r}^{\prime}\ \psi(\mathbf{r})C^{-1}(\mathbf{r},% \mathbf{r}^{\prime})\psi(\mathbf{r}^{\prime})-i\beta\int\mathrm{d}\mathbf{r}\ % \hat{\rho}_{c}(\mathbf{r})\psi(\mathbf{r})\bigg{\}}\\ &=C_{\psi}\int\mathcal{D}\psi\ \exp\bigg{\{}\int\mathrm{d}\mathbf{r}\ \bigg{[}% \frac{\epsilon(\mathbf{r})}{2}\lvert i\psi(\mathbf{r})\rvert^{2}-\hat{\rho}_{c% }i\psi(\mathbf{r})\bigg{]}\bigg{\}}\ ,\end{split}start_ROW start_CELL roman_exp { - divide start_ARG italic_β end_ARG start_ARG 2 end_ARG end_CELL start_CELL ∫ roman_d bold_r roman_d bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT over^ start_ARG italic_ρ end_ARG start_POSTSUBSCRIPT italic_c end_POSTSUBSCRIPT ( bold_r ) italic_C ( bold_r , bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT ) over^ start_ARG italic_ρ end_ARG start_POSTSUBSCRIPT italic_c end_POSTSUBSCRIPT ( bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT ) } end_CELL end_ROW start_ROW start_CELL end_CELL start_CELL = italic_C start_POSTSUBSCRIPT italic_ψ end_POSTSUBSCRIPT ∫ caligraphic_D italic_ψ roman_exp { - divide start_ARG italic_β end_ARG start_ARG 2 end_ARG ∫ roman_d bold_r roman_d bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT italic_ψ ( bold_r ) italic_C start_POSTSUPERSCRIPT - 1 end_POSTSUPERSCRIPT ( bold_r , bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT ) italic_ψ ( bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT ) - italic_i italic_β ∫ roman_d bold_r over^ start_ARG italic_ρ end_ARG start_POSTSUBSCRIPT italic_c end_POSTSUBSCRIPT ( bold_r ) italic_ψ ( bold_r ) } end_CELL end_ROW start_ROW start_CELL end_CELL start_CELL = italic_C start_POSTSUBSCRIPT italic_ψ end_POSTSUBSCRIPT ∫ caligraphic_D italic_ψ roman_exp { ∫ roman_d bold_r [ divide start_ARG italic_ϵ ( bold_r ) end_ARG start_ARG 2 end_ARG | italic_i italic_ψ ( bold_r ) | start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT - over^ start_ARG italic_ρ end_ARG start_POSTSUBSCRIPT italic_c end_POSTSUBSCRIPT italic_i italic_ψ ( bold_r ) ] } , end_CELL end_ROW (S6)

where in the last step, the dielectric constant and electrostatic potential were made dimensionless: ϵ=ϵ/(βe2)italic-ϵitalic-ϵ𝛽superscript𝑒2\epsilon=\epsilon/(\beta e^{2})italic_ϵ = italic_ϵ / ( italic_β italic_e start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT ), ψ=βeψ𝜓𝛽𝑒𝜓\psi=\beta e\psiitalic_ψ = italic_β italic_e italic_ψ. C1(𝐫,𝐫)=[ϵ(𝐫)]δ(𝐫𝐫)superscript𝐶1𝐫superscript𝐫delimited-[]italic-ϵ𝐫𝛿𝐫superscript𝐫C^{-1}(\mathbf{r},\mathbf{r}^{\prime})=-\nabla\cdot\big{[}\epsilon(\mathbf{r})% \nabla\big{]}\delta(\mathbf{r}-\mathbf{r}^{\prime})italic_C start_POSTSUPERSCRIPT - 1 end_POSTSUPERSCRIPT ( bold_r , bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT ) = - ∇ ⋅ [ italic_ϵ ( bold_r ) ∇ ] italic_δ ( bold_r - bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT ) is the functional inverse of the Coulomb operator, C(𝐫,𝐫)𝐶𝐫superscript𝐫C(\mathbf{r},\mathbf{r}^{\prime})italic_C ( bold_r , bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT ). The normalization constant, Cψ1=𝒟ψexp{(β/2)d𝐫d𝐫ψ(𝐫)C1(𝐫,𝐫)ψ(𝐫)}superscriptsubscript𝐶𝜓1𝒟𝜓𝛽2differential-d𝐫differential-dsuperscript𝐫𝜓𝐫superscript𝐶1𝐫superscript𝐫𝜓superscript𝐫C_{\psi}^{-1}=\int\mathcal{D}\psi\ \exp\big{\{}-(\beta/2)\int\mathrm{d}\mathbf% {r}\mathrm{d}\mathbf{r}^{\prime}\ \psi(\mathbf{r})C^{-1}(\mathbf{r},\mathbf{r}% ^{\prime})\psi(\mathbf{r}^{\prime})\big{\}}italic_C start_POSTSUBSCRIPT italic_ψ end_POSTSUBSCRIPT start_POSTSUPERSCRIPT - 1 end_POSTSUPERSCRIPT = ∫ caligraphic_D italic_ψ roman_exp { - ( italic_β / 2 ) ∫ roman_d bold_r roman_d bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT italic_ψ ( bold_r ) italic_C start_POSTSUPERSCRIPT - 1 end_POSTSUPERSCRIPT ( bold_r , bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT ) italic_ψ ( bold_r start_POSTSUPERSCRIPT ′ end_POSTSUPERSCRIPT ) }, is discarded as it will only shift the partition function by a constant.

The final partition function is thus:

Ξ=i=1ξ𝒟ϕi𝒟wi𝒟ϕs𝒟ws𝒟η𝒟ψexp(eβμsQsns)Qpnpnp!exp{1νd𝐫[i=1ξ(χiϕiϕs+jiξχij2ϕiϕj)+i=1ξiwiϕi+iwsϕs+iη(ϕp+ϕs1)]}exp{1νd𝐫[ϵ2|iψ|2+λ±exp(z±iψ)+iψi=1ξαiνϕi]},Ξsuperscriptsubscriptproduct𝑖1𝜉𝒟subscriptitalic-ϕ𝑖𝒟subscript𝑤𝑖𝒟subscriptitalic-ϕ𝑠𝒟subscript𝑤𝑠𝒟𝜂𝒟𝜓superscript𝑒𝛽subscript𝜇𝑠superscriptsubscript𝑄𝑠subscript𝑛𝑠superscriptsubscript𝑄𝑝subscript𝑛𝑝subscript𝑛𝑝1𝜈differential-d𝐫delimited-[]superscriptsubscript𝑖1𝜉subscript𝜒𝑖subscriptitalic-ϕ𝑖subscriptitalic-ϕ𝑠superscriptsubscript𝑗𝑖𝜉subscript𝜒𝑖𝑗2subscriptitalic-ϕ𝑖subscriptitalic-ϕ𝑗superscriptsubscript𝑖1𝜉𝑖subscript𝑤𝑖subscriptitalic-ϕ𝑖𝑖subscript𝑤𝑠subscriptitalic-ϕ𝑠𝑖𝜂subscriptitalic-ϕ𝑝subscriptitalic-ϕ𝑠11𝜈differential-d𝐫delimited-[]italic-ϵ2superscript𝑖𝜓2subscript𝜆plus-or-minusminus-or-plussubscript𝑧plus-or-minus𝑖𝜓𝑖𝜓superscriptsubscript𝑖1𝜉subscript𝛼𝑖𝜈subscriptitalic-ϕ𝑖\begin{split}\Xi=&\int\prod_{i=1}^{\xi}\mathcal{D}\phi_{i}\mathcal{D}w_{i}% \mathcal{D}\phi_{s}\mathcal{D}w_{s}\mathcal{D}\eta\mathcal{D}\psi\ \exp(e^{% \beta\mu_{s}}Q_{s}^{n_{s}})\ \frac{Q_{p}^{n_{p}}}{n_{p}!}\\ &\exp\bigg{\{}\frac{1}{\nu}\int\mathrm{d}\mathbf{r}\ \bigg{[}\sum_{i=1}^{\xi}% \big{(}\chi_{i}\phi_{i}\phi_{s}+\sum_{j\neq i}^{\xi}\frac{\chi_{ij}}{2}\phi_{i% }\phi_{j}\big{)}+\sum_{i=1}^{\xi}iw_{i}\phi_{i}+iw_{s}\phi_{s}+i\eta\big{(}% \phi_{p}+\phi_{s}-1\big{)}\bigg{]}\bigg{\}}\\ &\exp\bigg{\{}\frac{1}{\nu}\int\mathrm{d}\mathbf{r}\ \bigg{[}\frac{\epsilon}{2% }\lvert i\psi\rvert^{2}+\lambda_{\pm}\exp\big{(}\mp z_{\pm}i\psi\big{)}+i\psi% \sum_{i=1}^{\xi}\frac{\alpha_{i}}{\nu}\phi_{i}\bigg{]}\bigg{\}}\ ,\end{split}start_ROW start_CELL roman_Ξ = end_CELL start_CELL ∫ ∏ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT caligraphic_D italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT caligraphic_D italic_w start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT caligraphic_D italic_ϕ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT caligraphic_D italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT caligraphic_D italic_η caligraphic_D italic_ψ roman_exp ( italic_e start_POSTSUPERSCRIPT italic_β italic_μ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT end_POSTSUPERSCRIPT italic_Q start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_n start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT end_POSTSUPERSCRIPT ) divide start_ARG italic_Q start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_n start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT end_POSTSUPERSCRIPT end_ARG start_ARG italic_n start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ! end_ARG end_CELL end_ROW start_ROW start_CELL end_CELL start_CELL roman_exp { divide start_ARG 1 end_ARG start_ARG italic_ν end_ARG ∫ roman_d bold_r [ ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT ( italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT + ∑ start_POSTSUBSCRIPT italic_j ≠ italic_i end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT divide start_ARG italic_χ start_POSTSUBSCRIPT italic_i italic_j end_POSTSUBSCRIPT end_ARG start_ARG 2 end_ARG italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_j end_POSTSUBSCRIPT ) + ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT italic_i italic_w start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT + italic_i italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT + italic_i italic_η ( italic_ϕ start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT + italic_ϕ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT - 1 ) ] } end_CELL end_ROW start_ROW start_CELL end_CELL start_CELL roman_exp { divide start_ARG 1 end_ARG start_ARG italic_ν end_ARG ∫ roman_d bold_r [ divide start_ARG italic_ϵ end_ARG start_ARG 2 end_ARG | italic_i italic_ψ | start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT + italic_λ start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT roman_exp ( ∓ italic_z start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT italic_i italic_ψ ) + italic_i italic_ψ ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT divide start_ARG italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT end_ARG start_ARG italic_ν end_ARG italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ] } , end_CELL end_ROW (S7)

where ϕp(𝐫)=i=1ξϕi(𝐫)subscriptitalic-ϕ𝑝𝐫superscriptsubscript𝑖1𝜉subscriptitalic-ϕ𝑖𝐫\phi_{p}(\mathbf{r})=\sum_{i=1}^{\xi}\phi_{i}(\mathbf{r})italic_ϕ start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ( bold_r ) = ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( bold_r ) is the total protein density and λ±=eμ±/ν±subscript𝜆plus-or-minussuperscript𝑒subscript𝜇plus-or-minussubscript𝜈plus-or-minus\lambda_{\pm}=e^{\mu_{\pm}}/\nu_{\pm}italic_λ start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT = italic_e start_POSTSUPERSCRIPT italic_μ start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT end_POSTSUPERSCRIPT / italic_ν start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT is the fugacity of the ions. Here, we consider a one-dimensional planar system, where the protein densities vary only in the z𝑧zitalic_z-direction but remain homogeneous in the xy𝑥𝑦xyitalic_x italic_y-plane. After applying the saddle-point approximation and replacing iΨΨ𝑖ΨΨi\Psi\to\Psiitalic_i roman_Ψ → roman_Ψ for the purely imaginary saddle-point values in the fields Ψ=ϕi,wi,ϕs,ws,η,ψΨsubscriptitalic-ϕ𝑖subscript𝑤𝑖subscriptitalic-ϕ𝑠subscript𝑤𝑠𝜂𝜓\Psi=\phi_{i},w_{i},\phi_{s},w_{s},\eta,\psiroman_Ψ = italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT , italic_w start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT , italic_ϕ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT , italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT , italic_η , italic_ψ, we arrive at the equilibrium free energy per unit area (Eq. 5 in the main text):

F=𝐹absent\displaystyle F=italic_F = σlnQpeμsQs𝜎subscript𝑄𝑝superscript𝑒subscript𝜇𝑠subscript𝑄𝑠\displaystyle-\sigma\ln Q_{p}-e^{\mu_{s}}Q_{s}- italic_σ roman_ln italic_Q start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT - italic_e start_POSTSUPERSCRIPT italic_μ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT end_POSTSUPERSCRIPT italic_Q start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT
+1νdz[i=1ξ(χiϕiϕswiϕi)wsϕsη(ϕp+ϕs1)]1𝜈dzdelimited-[]superscriptsubscript𝑖1𝜉subscript𝜒𝑖subscriptitalic-ϕ𝑖subscriptitalic-ϕ𝑠subscript𝑤𝑖subscriptitalic-ϕ𝑖subscript𝑤𝑠subscriptitalic-ϕ𝑠𝜂subscriptitalic-ϕ𝑝subscriptitalic-ϕ𝑠1\displaystyle+\frac{1}{\nu}\int\mathrm{dz}\ \bigg{[}\sum_{i=1}^{\xi}\big{(}% \chi_{i}\phi_{i}\phi_{s}-w_{i}\phi_{i}\big{)}-w_{s}\phi_{s}-\eta\big{(}\phi_{p% }+\phi_{s}-1\big{)}\bigg{]}+ divide start_ARG 1 end_ARG start_ARG italic_ν end_ARG ∫ roman_dz [ ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT ( italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT - italic_w start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ) - italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT - italic_η ( italic_ϕ start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT + italic_ϕ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT - 1 ) ]
+dz[ϵ2|ψ|2+ψνi=1ξαiϕic+c],dzdelimited-[]italic-ϵ2superscript𝜓2𝜓𝜈superscriptsubscript𝑖1𝜉subscript𝛼𝑖subscriptitalic-ϕ𝑖subscript𝑐subscript𝑐\displaystyle+\int\mathrm{dz}\ \bigg{[}-\frac{\epsilon}{2}\lvert\nabla\psi% \rvert^{2}+\frac{\psi}{\nu}\sum_{i=1}^{\xi}\alpha_{i}\phi_{i}-c_{+}-c_{-}\bigg% {]}\ ,+ ∫ roman_dz [ - divide start_ARG italic_ϵ end_ARG start_ARG 2 end_ARG | ∇ italic_ψ | start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT + divide start_ARG italic_ψ end_ARG start_ARG italic_ν end_ARG ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT - italic_c start_POSTSUBSCRIPT + end_POSTSUBSCRIPT - italic_c start_POSTSUBSCRIPT - end_POSTSUBSCRIPT ] , (S8)

where c±=λ±exp(z±ψ)subscript𝑐plus-or-minussubscript𝜆plus-or-minusminus-or-plussubscript𝑧plus-or-minus𝜓c_{\pm}=\lambda_{\pm}\exp(\mp z_{\pm}\psi)italic_c start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT = italic_λ start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT roman_exp ( ∓ italic_z start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT italic_ψ ) is the ion concentration and χij=0subscript𝜒𝑖𝑗0\chi_{ij}=0italic_χ start_POSTSUBSCRIPT italic_i italic_j end_POSTSUBSCRIPT = 0 is assumed. Thus, σ=np/A𝜎subscript𝑛𝑝𝐴\sigma=n_{p}/Aitalic_σ = italic_n start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT / italic_A is the grafting density of the protein brush, where A𝐴Aitalic_A is the area of the plate. After functional minimization of F𝐹Fitalic_F with respect to all the fields (i.e., ϕi,wi,ws,η,ψsubscriptitalic-ϕ𝑖subscript𝑤𝑖subscript𝑤𝑠𝜂𝜓\phi_{i},w_{i},w_{s},\eta,\psiitalic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT , italic_w start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT , italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT , italic_η , italic_ψ) in addition to assuming that ϵ(z)italic-ϵz\epsilon(\mathrm{z})italic_ϵ ( roman_z ) can be expressed as a function of ϕi(z)subscriptitalic-ϕ𝑖z\phi_{i}(\mathrm{z})italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( roman_z ), we obtain the following coupled, self-consistent field equations:

wi(z)subscript𝑤𝑖z\displaystyle w_{i}(\mathrm{z})italic_w start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( roman_z ) =χiϕs(z)αiψ(z)ν2ϵ(z)ϕi|dψ(z)dz|2η(z)absentsubscript𝜒𝑖subscriptitalic-ϕ𝑠zsubscript𝛼𝑖𝜓z𝜈2italic-ϵzsubscriptitalic-ϕ𝑖superscript𝑑𝜓z𝑑z2𝜂z\displaystyle=\chi_{i}\phi_{s}(\mathrm{z})-\alpha_{i}\psi(\mathrm{z})-\frac{% \nu}{2}\frac{\partial\epsilon(\mathrm{z})}{\partial\phi_{i}}\bigg{\lvert}\frac% {d\psi(\mathrm{z})}{d\mathrm{z}}\bigg{\rvert}^{2}-\eta(\mathrm{z})= italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( roman_z ) - italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ψ ( roman_z ) - divide start_ARG italic_ν end_ARG start_ARG 2 end_ARG divide start_ARG ∂ italic_ϵ ( roman_z ) end_ARG start_ARG ∂ italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT end_ARG | divide start_ARG italic_d italic_ψ ( roman_z ) end_ARG start_ARG italic_d roman_z end_ARG | start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT - italic_η ( roman_z ) (S9a)
ws(z)subscript𝑤𝑠z\displaystyle w_{s}(\mathrm{z})italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( roman_z ) =i=1ξχiϕi(z)η(z)absentsuperscriptsubscript𝑖1𝜉subscript𝜒𝑖subscriptitalic-ϕ𝑖z𝜂z\displaystyle=\sum_{i=1}^{\xi}\chi_{i}\phi_{i}(\mathrm{z})-\eta(\mathrm{z})= ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( roman_z ) - italic_η ( roman_z ) (S9b)
ϕi(z)subscriptitalic-ϕ𝑖z\displaystyle\phi_{i}(\mathrm{z})italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( roman_z ) =σQpj=0i1Njj=0iNjdsq(z;s)qc(z;s)absent𝜎subscript𝑄𝑝superscriptsubscriptsuperscriptsubscript𝑗0𝑖1subscript𝑁𝑗superscriptsubscript𝑗0𝑖subscript𝑁𝑗ds𝑞zssubscript𝑞𝑐zs\displaystyle=\frac{\sigma}{Q_{p}}\int_{\sum_{j=0}^{i-1}N_{j}}^{\sum_{j=0}^{i}% N_{j}}\mathrm{ds}\ q(\mathrm{z};\mathrm{s})q_{c}(\mathrm{z};\mathrm{s})= divide start_ARG italic_σ end_ARG start_ARG italic_Q start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT end_ARG ∫ start_POSTSUBSCRIPT ∑ start_POSTSUBSCRIPT italic_j = 0 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_i - 1 end_POSTSUPERSCRIPT italic_N start_POSTSUBSCRIPT italic_j end_POSTSUBSCRIPT end_POSTSUBSCRIPT start_POSTSUPERSCRIPT ∑ start_POSTSUBSCRIPT italic_j = 0 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_i end_POSTSUPERSCRIPT italic_N start_POSTSUBSCRIPT italic_j end_POSTSUBSCRIPT end_POSTSUPERSCRIPT roman_ds italic_q ( roman_z ; roman_s ) italic_q start_POSTSUBSCRIPT italic_c end_POSTSUBSCRIPT ( roman_z ; roman_s ) (S9c)
ϕs(z)subscriptitalic-ϕ𝑠z\displaystyle\phi_{s}(\mathrm{z})italic_ϕ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( roman_z ) =eμsexp(ws(z))absentsuperscript𝑒subscript𝜇𝑠subscript𝑤𝑠z\displaystyle=e^{\mu_{s}}\exp\big{(}-w_{s}(\mathrm{z})\big{)}= italic_e start_POSTSUPERSCRIPT italic_μ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT end_POSTSUPERSCRIPT roman_exp ( - italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( roman_z ) ) (S9d)
ddz(ϵ(z)ddzψ(z))𝑑𝑑zitalic-ϵz𝑑𝑑z𝜓z\displaystyle-\frac{d}{d\mathrm{z}}\bigg{(}\epsilon(\mathrm{z})\frac{d}{d% \mathrm{z}}\psi(\mathrm{z})\bigg{)}- divide start_ARG italic_d end_ARG start_ARG italic_d roman_z end_ARG ( italic_ϵ ( roman_z ) divide start_ARG italic_d end_ARG start_ARG italic_d roman_z end_ARG italic_ψ ( roman_z ) ) =z+c+(z)zc(z)+i=1ξαiνϕi(z)absentsubscript𝑧subscript𝑐zsubscript𝑧subscript𝑐zsuperscriptsubscript𝑖1𝜉subscript𝛼𝑖𝜈subscriptitalic-ϕ𝑖z\displaystyle=z_{+}c_{+}(\mathrm{z})-z_{-}c_{-}(\mathrm{z})+\sum_{i=1}^{\xi}% \frac{\alpha_{i}}{\nu}\phi_{i}(\mathrm{z})= italic_z start_POSTSUBSCRIPT + end_POSTSUBSCRIPT italic_c start_POSTSUBSCRIPT + end_POSTSUBSCRIPT ( roman_z ) - italic_z start_POSTSUBSCRIPT - end_POSTSUBSCRIPT italic_c start_POSTSUBSCRIPT - end_POSTSUBSCRIPT ( roman_z ) + ∑ start_POSTSUBSCRIPT italic_i = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_ξ end_POSTSUPERSCRIPT divide start_ARG italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT end_ARG start_ARG italic_ν end_ARG italic_ϕ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT ( roman_z ) (S9e)

For the Poisson-Boltzmann Equation (Eq. S9e), dψ/dz=0𝑑𝜓𝑑z0d\psi/d\mathrm{z}=0italic_d italic_ψ / italic_d roman_z = 0 and ψ(z)=0𝜓z0\psi(\mathrm{z})=0italic_ψ ( roman_z ) = 0 are used for the boundary conditions at z=0z0\mathrm{z}=0roman_z = 0 and z=z\mathrm{z}=\inftyroman_z = ∞, respectively. For the modified diffusion equation (Eq. S5), q(z;s)=0𝑞z𝑠0q(\mathrm{z};s)=0italic_q ( roman_z ; italic_s ) = 0 is used at both boundaries. The corresponding boundary conditions for qc(z;s)subscript𝑞𝑐z𝑠q_{c}(\mathrm{z};s)italic_q start_POSTSUBSCRIPT italic_c end_POSTSUBSCRIPT ( roman_z ; italic_s ) are identical to q(z;s)𝑞z𝑠q(\mathrm{z};s)italic_q ( roman_z ; italic_s ). However, the initial conditions are not: q(z;0)=δ(zz)𝑞z0𝛿zsuperscriptzq(\mathrm{z};0)=\delta(\mathrm{z}-\mathrm{z}^{*})italic_q ( roman_z ; 0 ) = italic_δ ( roman_z - roman_z start_POSTSUPERSCRIPT ∗ end_POSTSUPERSCRIPT ) with z0+superscript𝑧subscript0z^{*}\to 0_{+}italic_z start_POSTSUPERSCRIPT ∗ end_POSTSUPERSCRIPT → 0 start_POSTSUBSCRIPT + end_POSTSUBSCRIPT and qc(z;N)=1subscript𝑞𝑐z𝑁1q_{c}(\mathrm{z};N)=1italic_q start_POSTSUBSCRIPT italic_c end_POSTSUBSCRIPT ( roman_z ; italic_N ) = 1.

The charge densities of amino acids at bulk pH, αbsuperscriptsubscript𝛼𝑏\alpha_{b}^{*}italic_α start_POSTSUBSCRIPT italic_b end_POSTSUBSCRIPT start_POSTSUPERSCRIPT ∗ end_POSTSUPERSCRIPT, are related to the dissociation constants pKasubscriptpKa\mathrm{pK_{a}}roman_pK start_POSTSUBSCRIPT roman_a end_POSTSUBSCRIPT and pKbsubscriptpKb\mathrm{pK_{b}}roman_pK start_POSTSUBSCRIPT roman_b end_POSTSUBSCRIPT for the acidic and basic residues, respectively. From the Henderson-Hasselbalch equation, log10r+b=(pHpKb)subscript10superscriptsubscript𝑟𝑏pHsubscriptpKb\log_{10}r_{+}^{b}=-(\mathrm{pH-pK_{b}})roman_log start_POSTSUBSCRIPT 10 end_POSTSUBSCRIPT italic_r start_POSTSUBSCRIPT + end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_b end_POSTSUPERSCRIPT = - ( roman_pH - roman_pK start_POSTSUBSCRIPT roman_b end_POSTSUBSCRIPT ), where r+bsuperscriptsubscript𝑟𝑏r_{+}^{b}italic_r start_POSTSUBSCRIPT + end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_b end_POSTSUPERSCRIPT is the ratio of the number of positively charged residues to the number of uncharged residues at bulk conditions. Similarly, log10rb=pHpKasubscript10superscriptsubscript𝑟𝑏pHsubscriptpKa\log_{10}r_{-}^{b}=\mathrm{pH-pK_{a}}roman_log start_POSTSUBSCRIPT 10 end_POSTSUBSCRIPT italic_r start_POSTSUBSCRIPT - end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_b end_POSTSUPERSCRIPT = roman_pH - roman_pK start_POSTSUBSCRIPT roman_a end_POSTSUBSCRIPT for the ratio of negatively charged to uncharged residues. Thus, for an arbitrary amino acid, the bulk charge density can be calculated using the following equation:

αb=r+b1+r+brb1+rbsuperscriptsubscript𝛼𝑏superscriptsubscript𝑟𝑏1superscriptsubscript𝑟𝑏superscriptsubscript𝑟𝑏1superscriptsubscript𝑟𝑏\alpha_{b}^{*}=\frac{r_{+}^{b}}{1+r_{+}^{b}}-\frac{r_{-}^{b}}{1+r_{-}^{b}}italic_α start_POSTSUBSCRIPT italic_b end_POSTSUBSCRIPT start_POSTSUPERSCRIPT ∗ end_POSTSUPERSCRIPT = divide start_ARG italic_r start_POSTSUBSCRIPT + end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_b end_POSTSUPERSCRIPT end_ARG start_ARG 1 + italic_r start_POSTSUBSCRIPT + end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_b end_POSTSUPERSCRIPT end_ARG - divide start_ARG italic_r start_POSTSUBSCRIPT - end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_b end_POSTSUPERSCRIPT end_ARG start_ARG 1 + italic_r start_POSTSUBSCRIPT - end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_b end_POSTSUPERSCRIPT end_ARG (S10)

The charge density αisubscript𝛼𝑖\alpha_{i}italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT of block i𝑖iitalic_i can then be calculated by adding the charge densities of its constituent amino acids.

4.2.2 II.2. Annealed Charge Model for Proteins

Our theory can also incorporate an explicit treatment of the local proton concentration for a more rigorous treatment of the residue dissociation reaction. This is especially important at high pH, at which the hydrogen concentration in the brush may vary significantly from the bulk value. To illustrate the methodology, we summarize here the derivation for a simplified case in which all the residues are basic with the same value of pKbsubscriptpKb\mathrm{pK_{b}}roman_pK start_POSTSUBSCRIPT roman_b end_POSTSUBSCRIPT. It can be easily generalized to model real proteins where the dissociation constant of each residue is different. A general idea is to modify the previous quenched model by the following two aspects: (1) the chemical distinguishability of \chH+ and \chOH- from salt ions (±plus-or-minus\pm±) and the new corresponding chemical potentials μ\chH+subscript𝜇limit-from\ch𝐻\mu_{\ch{H+}}italic_μ start_POSTSUBSCRIPT italic_H + end_POSTSUBSCRIPT and μ\chOHsubscript𝜇limit-from\ch𝑂𝐻\mu_{\ch{OH-}}italic_μ start_POSTSUBSCRIPT italic_O italic_H - end_POSTSUBSCRIPT; (2) the introduction of the microscopic protein charge density operator. Taking a polybase with the same pKbsubscriptpKb\mathrm{pK_{b}}roman_pK start_POSTSUBSCRIPT roman_b end_POSTSUBSCRIPT for all the residues as an example, the charge density operator α^(𝐫)^𝛼𝐫\hat{\alpha}(\mathbf{r})over^ start_ARG italic_α end_ARG ( bold_r ) can be written as

α^(𝐫)=C=1nCδ(𝐫𝐫C)k=1np0Nδ(𝐫𝐑k(s)),^𝛼𝐫superscriptsubscript𝐶1subscript𝑛𝐶𝛿𝐫subscript𝐫𝐶superscriptsubscript𝑘1subscript𝑛𝑝superscriptsubscript0𝑁𝛿𝐫subscript𝐑𝑘𝑠\hat{\alpha}(\mathbf{r})=\frac{\sum_{C=1}^{n_{C}}\delta(\mathbf{r}-\mathbf{r}_% {C})}{\sum_{k=1}^{n_{p}}\int_{0}^{N}\delta(\mathbf{r}-\mathbf{R}_{k}(s))}~{},over^ start_ARG italic_α end_ARG ( bold_r ) = divide start_ARG ∑ start_POSTSUBSCRIPT italic_C = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_n start_POSTSUBSCRIPT italic_C end_POSTSUBSCRIPT end_POSTSUPERSCRIPT italic_δ ( bold_r - bold_r start_POSTSUBSCRIPT italic_C end_POSTSUBSCRIPT ) end_ARG start_ARG ∑ start_POSTSUBSCRIPT italic_k = 1 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_n start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT end_POSTSUPERSCRIPT ∫ start_POSTSUBSCRIPT 0 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_N end_POSTSUPERSCRIPT italic_δ ( bold_r - bold_R start_POSTSUBSCRIPT italic_k end_POSTSUBSCRIPT ( italic_s ) ) end_ARG , (S11)

where 𝐫Csubscript𝐫𝐶\mathbf{r}_{C}bold_r start_POSTSUBSCRIPT italic_C end_POSTSUBSCRIPT are the locations of each of the nCsubscript𝑛𝐶n_{C}italic_n start_POSTSUBSCRIPT italic_C end_POSTSUBSCRIPT charged segments. A similar operator for the microscopic protein uncharged fraction operator α^0subscript^𝛼0\hat{\alpha}_{0}over^ start_ARG italic_α end_ARG start_POSTSUBSCRIPT 0 end_POSTSUBSCRIPT is also introduced. To specify α^^𝛼\hat{\alpha}over^ start_ARG italic_α end_ARG as the amount of charge from the dissociated residues, the delta function 𝐫δ[α^(𝐫)ϕ^p(𝐫)+α^0ϕ^p(𝐫)ϕ^p(𝐫)]subscriptproduct𝐫𝛿delimited-[]^𝛼𝐫subscript^italic-ϕ𝑝𝐫subscript^𝛼0subscript^italic-ϕ𝑝𝐫subscript^italic-ϕ𝑝𝐫\prod_{\mathbf{r}}\delta[\hat{\alpha}(\mathbf{r})\hat{\phi}_{p}(\mathbf{r})+% \hat{\alpha}_{0}\hat{\phi}_{p}(\mathbf{r})-\hat{\phi}_{p}(\mathbf{r})]∏ start_POSTSUBSCRIPT bold_r end_POSTSUBSCRIPT italic_δ [ over^ start_ARG italic_α end_ARG ( bold_r ) over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ( bold_r ) + over^ start_ARG italic_α end_ARG start_POSTSUBSCRIPT 0 end_POSTSUBSCRIPT over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ( bold_r ) - over^ start_ARG italic_ϕ end_ARG start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ( bold_r ) ] is incorporated into the partition function.

After following the standard self-consistent field procedure as described at the beginning of this section, we arrive at a set of self-consistent field equations similar to Eqs. S9:

wp(z)subscript𝑤𝑝z\displaystyle w_{p}(\mathrm{z})italic_w start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ( roman_z ) =χϕs(z)+η(z)absent𝜒subscriptitalic-ϕ𝑠z𝜂z\displaystyle=\chi\phi_{s}(\mathrm{z})+\eta(\mathrm{z})= italic_χ italic_ϕ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( roman_z ) + italic_η ( roman_z ) (S12)
ws(z)subscript𝑤𝑠z\displaystyle w_{s}(\mathrm{z})italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( roman_z ) =χϕp(z)+η(z)absent𝜒subscriptitalic-ϕ𝑝z𝜂z\displaystyle=\chi\phi_{p}(\mathrm{z})+\eta(\mathrm{z})= italic_χ italic_ϕ start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ( roman_z ) + italic_η ( roman_z ) (S13)
ϕp(z)subscriptitalic-ϕ𝑝z\displaystyle\phi_{p}(\mathrm{z})italic_ϕ start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ( roman_z ) =σQp0Ndsq(z;s)qc(z;s)absent𝜎subscript𝑄𝑝superscriptsubscript0𝑁ds𝑞zssubscript𝑞𝑐zs\displaystyle=\frac{\sigma}{Q_{p}}\int_{0}^{N}\mathrm{ds}\ q(\mathrm{z};% \mathrm{s})q_{c}(\mathrm{z};\mathrm{s})= divide start_ARG italic_σ end_ARG start_ARG italic_Q start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT end_ARG ∫ start_POSTSUBSCRIPT 0 end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_N end_POSTSUPERSCRIPT roman_ds italic_q ( roman_z ; roman_s ) italic_q start_POSTSUBSCRIPT italic_c end_POSTSUBSCRIPT ( roman_z ; roman_s ) (S14)
ϕs(z)subscriptitalic-ϕ𝑠z\displaystyle\phi_{s}(\mathrm{z})italic_ϕ start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( roman_z ) =esμexp(ws(z))absentsubscriptsuperscript𝑒𝜇𝑠subscript𝑤𝑠z\displaystyle=e^{\mu}_{s}\exp\big{(}-w_{s}(\mathrm{z})\big{)}= italic_e start_POSTSUPERSCRIPT italic_μ end_POSTSUPERSCRIPT start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT roman_exp ( - italic_w start_POSTSUBSCRIPT italic_s end_POSTSUBSCRIPT ( roman_z ) ) (S15)
ddz(ϵ(z)ddzψ(z))𝑑𝑑𝑧italic-ϵz𝑑𝑑𝑧𝜓z\displaystyle-\frac{d}{dz}\bigg{(}\epsilon(\mathrm{z})\frac{d}{dz}\psi(\mathrm% {z})\bigg{)}- divide start_ARG italic_d end_ARG start_ARG italic_d italic_z end_ARG ( italic_ϵ ( roman_z ) divide start_ARG italic_d end_ARG start_ARG italic_d italic_z end_ARG italic_ψ ( roman_z ) ) =γZγcγ(z)+α(z)νϕp(z),absentsubscript𝛾subscript𝑍𝛾subscript𝑐𝛾z𝛼z𝜈subscriptitalic-ϕ𝑝z\displaystyle=\sum_{\gamma}Z_{\gamma}c_{\gamma}(\mathrm{z})+\frac{\alpha(% \mathrm{z})}{\nu}\phi_{p}(\mathrm{z})~{},= ∑ start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT italic_Z start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT italic_c start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT ( roman_z ) + divide start_ARG italic_α ( roman_z ) end_ARG start_ARG italic_ν end_ARG italic_ϕ start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ( roman_z ) , (S16)

where γ=±,\chH+,\chOH𝛾plus-or-minuslimit-from\ch𝐻limit-from\ch𝑂𝐻\gamma=\pm,\ch{H+},\ch{OH-}italic_γ = ± , italic_H + , italic_O italic_H -. Zγsubscript𝑍𝛾Z_{\gamma}italic_Z start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT is the charge of each ion. cγ(z)=λγexp(Zγψ(z))subscript𝑐𝛾zsubscript𝜆𝛾subscript𝑍𝛾𝜓zc_{\gamma}(\mathrm{z})=\lambda_{\gamma}\exp\big{(}-Z_{\gamma}\psi(\mathrm{z})% \big{)}italic_c start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT ( roman_z ) = italic_λ start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT roman_exp ( - italic_Z start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT italic_ψ ( roman_z ) ) is the ion concentration, where λγ=eμγ/νγsubscript𝜆𝛾superscript𝑒subscript𝜇𝛾subscript𝜈𝛾\lambda_{\gamma}=e^{\mu_{\gamma}}/\nu_{\gamma}italic_λ start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT = italic_e start_POSTSUPERSCRIPT italic_μ start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT end_POSTSUPERSCRIPT / italic_ν start_POSTSUBSCRIPT italic_γ end_POSTSUBSCRIPT is the fugacity of the ions determined by the bulk ion concentration c±bsuperscriptsubscript𝑐plus-or-minus𝑏c_{\pm}^{b}italic_c start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_b end_POSTSUPERSCRIPT for salt ions and the bulk pH for \chH+ and \chOH-. The local charge density α𝛼\alphaitalic_α of the polybase brush is related to its value in the bulk αb=r+b/(1+r+b)subscript𝛼𝑏superscriptsubscript𝑟𝑏1superscriptsubscript𝑟𝑏\alpha_{b}=r_{+}^{b}/(1+r_{+}^{b})italic_α start_POSTSUBSCRIPT italic_b end_POSTSUBSCRIPT = italic_r start_POSTSUBSCRIPT + end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_b end_POSTSUPERSCRIPT / ( 1 + italic_r start_POSTSUBSCRIPT + end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_b end_POSTSUPERSCRIPT ) as:

α(z)=αbeψ(z)1αb+αbeψ(z)𝛼zsubscript𝛼𝑏superscript𝑒𝜓z1subscript𝛼𝑏subscript𝛼𝑏superscript𝑒𝜓z\alpha(\mathrm{z})=\frac{\alpha_{b}e^{-\psi(\mathrm{z})}}{1-\alpha_{b}+\alpha_% {b}e^{-\psi(\mathrm{z})}}italic_α ( roman_z ) = divide start_ARG italic_α start_POSTSUBSCRIPT italic_b end_POSTSUBSCRIPT italic_e start_POSTSUPERSCRIPT - italic_ψ ( roman_z ) end_POSTSUPERSCRIPT end_ARG start_ARG 1 - italic_α start_POSTSUBSCRIPT italic_b end_POSTSUBSCRIPT + italic_α start_POSTSUBSCRIPT italic_b end_POSTSUBSCRIPT italic_e start_POSTSUPERSCRIPT - italic_ψ ( roman_z ) end_POSTSUPERSCRIPT end_ARG (S17)

The modified diffusion equation is then:

sq(z;s)=b26d2dz2q(z;s)(wp(z)+ζ(z)1)q(z;s),𝑠𝑞zssuperscript𝑏26superscript𝑑2𝑑superscript𝑧2𝑞z𝑠subscript𝑤𝑝z𝜁z1𝑞z𝑠\frac{\partial}{\partial s}q(\mathrm{z};\mathrm{s})=\frac{b^{2}}{6}\frac{d^{2}% }{dz^{2}}q(\mathrm{z};s)-\big{(}w_{p}(\mathrm{z})+\zeta(\mathrm{z})-1\big{)}q(% \mathrm{z};s)\;,divide start_ARG ∂ end_ARG start_ARG ∂ italic_s end_ARG italic_q ( roman_z ; roman_s ) = divide start_ARG italic_b start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT end_ARG start_ARG 6 end_ARG divide start_ARG italic_d start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT end_ARG start_ARG italic_d italic_z start_POSTSUPERSCRIPT 2 end_POSTSUPERSCRIPT end_ARG italic_q ( roman_z ; italic_s ) - ( italic_w start_POSTSUBSCRIPT italic_p end_POSTSUBSCRIPT ( roman_z ) + italic_ζ ( roman_z ) - 1 ) italic_q ( roman_z ; italic_s ) , (S18)

where ζ(z)=ln(1αb+αbeψ(z))𝜁z1subscript𝛼𝑏subscript𝛼𝑏superscript𝑒𝜓z\zeta(\mathrm{z})=-\ln\big{(}1-\alpha_{b}+\alpha_{b}e^{-\psi(\mathrm{z})}\big{)}italic_ζ ( roman_z ) = - roman_ln ( 1 - italic_α start_POSTSUBSCRIPT italic_b end_POSTSUBSCRIPT + italic_α start_POSTSUBSCRIPT italic_b end_POSTSUBSCRIPT italic_e start_POSTSUPERSCRIPT - italic_ψ ( roman_z ) end_POSTSUPERSCRIPT ).

4.3 III. Sensitivity Analysis of the Coarse-graining Procedure

In this section, the sensitivity analysis of the coarse-graining approach used in this work is provided. As shown in Fig. S1 below, after a threshold degree of coarse-graining (i.e., N>1𝑁1N>1italic_N > 1 here), enough chemical information is included and the height response is not significantly affected by the number of blocks used to represent the protein. In this work, we use N=5𝑁5N=5italic_N = 5.

Refer to caption
Figure S1: Height responses to varying ionic strengths at pH 2.4 of brushes comprised of NFH proteins represented by N=1,2,5,𝑁125N=1,2,5,italic_N = 1 , 2 , 5 , and 7777 number of blocks in the multi-block charged macromolecular model.

The charge density αisubscript𝛼𝑖\alpha_{i}italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT, and hydrophobicity χisubscript𝜒𝑖\chi_{i}italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT of coarse-grained blocks corresponding to N=1,2,5,𝑁125N=1,2,5,italic_N = 1 , 2 , 5 , and 7777 are provided in Table S1.

Table S1: Partitions of amino acid residues, charge density αisubscript𝛼𝑖\alpha_{i}italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT, and hydrophobicity χisubscript𝜒𝑖\chi_{i}italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT of coarse-grained blocks for NFH at pH 2.4 using N=1,2,5,𝑁125N=1,2,5,italic_N = 1 , 2 , 5 , and 7777 number of blocks in the multi-block charged macromolecular model.
N𝑁Nitalic_N i𝑖iitalic_i Residues αisubscript𝛼𝑖\alpha_{i}italic_α start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT χisubscript𝜒𝑖\chi_{i}italic_χ start_POSTSUBSCRIPT italic_i end_POSTSUBSCRIPT
1 1 [1,647]1647[1,~{}647][ 1 , 647 ] 0.209586 1.703555
2 1 [1,299]1299[1,~{}~{}~{}~{}299][ 1 , 299 ] 0.147222 1.939333
2 [300,647]300647[300,~{}647][ 300 , 647 ] 0.263503 1.499712
5 1 [1,28]128[1,~{}~{}~{}~{}~{}28][ 1 , 28 ] 0.204967 1.586207
2 [29,87]2987[29,~{}~{}~{}~{}87][ 29 , 87 ] 0.027801 1.434483
3 [88,319]88319[88,~{}~{}319][ 88 , 319 ] 0.170493 2.113793
4 [320,609]320609[320,~{}609][ 320 , 609 ] 0.261110 1.534483
5 [610,647]610647[610,~{}647][ 610 , 647 ] 0.336030 0.989474
7 1 [1,31]131[1,~{}~{}~{}~{}~{}31][ 1 , 31 ] 0.216566 1.456250
2 [32,95]3295[32,~{}~{}~{}~{}95][ 32 , 95 ] 0.056227 1.434375
3 [96,319]96319[96,~{}~{}319][ 96 , 319 ] 0.163313 2.166071
4 [320,511]320511[320,~{}511][ 320 , 511 ] 0.251197 1.584375
5 [512,543]512543[512,~{}543][ 512 , 543 ] 0.277333 1.643750
6 [544,607]544607[544,~{}607][ 544 , 607 ] 0.290897 1.253125
7 [608,647]608647[608,~{}647][ 608 , 647 ] 0.327414 1.066667

4.4 IV. Ionic Density Profiles Near the Substrate

In this section, representative ionic density profiles are provided. Fig. S2 shows the ionic density profiles normalized by the bulk ionic salt concentration c±bsuperscriptsubscript𝑐plus-or-minus𝑏c_{\pm}^{b}italic_c start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_b end_POSTSUPERSCRIPT. Comparing to the representative density profiles in Fig. 3 of the main text, the electric double layer is contained within the brush at high ionic strengths but extends outside of the brush at low ionic strengths.

Refer to caption
Figure S2: Representative ionic density profiles c±/c±bsubscript𝑐plus-or-minussuperscriptsubscript𝑐plus-or-minus𝑏c_{\pm}/c_{\pm}^{b}italic_c start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT / italic_c start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_b end_POSTSUPERSCRIPT for NFH brushes, where the bulk concentration c±b=4,6,10,50superscriptsubscript𝑐plus-or-minus𝑏461050c_{\pm}^{b}=4,6,10,50italic_c start_POSTSUBSCRIPT ± end_POSTSUBSCRIPT start_POSTSUPERSCRIPT italic_b end_POSTSUPERSCRIPT = 4 , 6 , 10 , 50 mM. z𝑧zitalic_z denotes the direction perpendicular to the surface. Anion concentration csubscript𝑐c_{-}italic_c start_POSTSUBSCRIPT - end_POSTSUBSCRIPT is shown in solid lines while cation concentration c+subscript𝑐c_{+}italic_c start_POSTSUBSCRIPT + end_POSTSUBSCRIPT is shown in dashed lines.