Latent-Y: A Lab-Validated Autonomous Agent for De Novo Drug Design
Abstract
Drug discovery relies on iterative expert workflows that are slow to parallelize and difficult to scale. Here we introduce Latent-Y, an AI agent that autonomously executes complete antibody design campaigns from text prompts, covering literature review, target analysis, epitope identification, candidate design, computational validation, and selection of lab-ready sequences. Latent-Y is integrated into the Latent Labs Platform, where it operates in the same environment as drug-discovery experts with access to bioinformatics tools, biological databases, and scientific literature. The agent can run fully autonomously end-to-end, or collaboratively, where researchers review progress, provide feedback, and direct subsequent steps. Candidate antibodies are generated using Latent-X2, our frontier generative model for drug-like antibody design. We demonstrate the agent’s capability across three distinct campaign types: epitope discovery guided by therapeutic specifications, cross-species binder design, and autonomous design from a scientific publication targeting human transferrin receptor for blood–brain barrier crossing. Across nine targets, Latent-Y produced lab-confirmed nanobody binders against six, achieving a target-level success rate with binding affinities reaching the single-digit nanomolar range, without human filtering or intervention. In user studies, experts working with Latent-Y completed design campaigns 56 times faster than independent expert time estimates, compressing weeks of work into hours. Because Latent-X2 is a general-purpose atomic-level model for biologics design, the same agent architecture naturally extends to macrocyclic peptide and mini-binder design campaigns, broadening autonomous discovery across therapeutic modalities. Latent-Y is available to selected partners at platform.latentlabs.com.
1 Introduction
Frontier AI models such as Latent-X2 [undef] and other molecular design models [undefa, undefb] have recently demonstrated the feasibility of zero-shot biologics design, directly producing antibody and peptide candidates that have drug-like properties and advancing prior work in protein structure prediction [undefc, undefd] and generative protein design [undefe, undeff, undefg, undefh, undefi, undefj, undefk, undefl, undefm].
In a world in which we can now design lab-ready molecules on the computer, the rate-limiting step for early drug discovery is no longer finding a candidate molecule for a drug program. The rate-limiting step instead becomes the bandwidth of drug-discovery organizations and access to the PhD-level domain expertise required to do so at scale.
To address this bottleneck, we developed Latent-Y, an agentic system for de novo drug design, capable of designing antibodies, peptides, and mini-binders from text descriptions of drug design goals. Latent-Y directly addresses the exploration and scale bottleneck by delivering autonomous drug design research that can be executed in parallel. We demonstrate, for the first time, that an autonomous agent can design lab-confirmed de novo antibody binders purely from text descriptions of goals and requirements, without requiring manual intervention in the design process. Latent-Y-designed nanobodies display strong binding affinities reaching single-digit nanomolar ranges, with highly competitive target-level success rates, hitting 6 of 9 targets attempted in the lab.
Where Latent-X2 reasons at the atomic level to design precise molecular interactions, Latent-Y operates in the same environment as human experts, applying expert-level reasoning to navigate from research objective to lab-ready candidates. It queries molecular and literature databases, orchestrates Latent-X2 to generate and score candidates, and employs bioinformatics tools to analyse the sequence and structure of targets, epitopes, and designed molecules. It intelligently explores a large combinatorial design space. It tests different hypotheses, analyses results, and integrates insights across parallel runs, plans appropriate next steps, and works towards user-provided goals, such as achieving an intended functional mechanism or producing the requested number of lab-ready designs.
In this work, Latent-Y is run both fully autonomously and collaboratively. The majority of campaigns were executed end to end without human intervention, while the cross-species campaign demonstrates tight human-agent collaboration, with the researcher steering strategy and the agent adapting in real time. Both modes are supported across the full spectrum of expert involvement. We show that Latent-Y significantly accelerates the work of protein design experts, reducing the time required for expert research and computational workflows from weeks to hours. This acceleration compounds when running Latent-Y instances at scale and in parallel, for example to find development candidates across multiple pre-clinical drug programs simultaneously.
Our main contributions are:
-
1.
The first autonomous agent for de novo biologics design, delivering lab-ready sequences from text input.
-
2.
Lab-validated de novo nanobody design from text, with a target-level success rate across 9 targets.
-
3.
Latent-Y-designed de novo nanobodies with single-digit nanomolar binding affinities, confirmed in the lab.
-
4.
A 56-fold acceleration of expert-led design campaigns with Latent-Y versus without, measured against independent expert time estimates.
-
5.
Lab-validated cross-species binder design via Latent-Y-generated custom generative code.
Availability. Latent-Y is integrated and available on the Latent Labs Platform at platform.latentlabs.com.
2 Results
We evaluate Latent-Y across three antibody design settings: epitope discovery campaigns targeting IL-6 [undefn], PRL [undefo], IL-33 [undefp], TNF [undefq], and SC2RBD [undefr], with the goal of therapeutic inhibition, and IL-6R [undefs], with the goal of target binding; cross-species reactivity campaigns against TNFL9 [undeft]; and literature-inferred design campaigns targeting hTfR1 [undefu]. Across these campaigns, Latent-Y achieves a target-level success rate of , with per-target hit rates ranging from of tested sequences, and binding affinities reaching the single-digit nanomolar range.
2.1 Latent-Yis a wet-lab-validated agent for drug design at scale
Latent-Yis natively integrated into the Latent Labs Platform and can be accessed entirely through a browser, steered by natural language. A researcher can provide a therapeutic objective as free text, a structured work plan specifying targets and constraints, or a scientific publication from which the agent autonomously extracts target identities, biological context, and design constraints, as shown in Fig. 1a.
Drug design problems are inherently underspecified at the outset: the right epitope, the appropriate structural context, and the relevant constraints often only become clear during the research process itself. Latent-Y is designed to reduce this ambiguity. Upon receiving a design objective, it consults scientific literature and databases to build biological context, identifies appropriate target structures, and characterizes candidate epitopes against functional criteria. Unlike fixed generative pipelines, it accepts and reasons about arbitrary research constraints such as modality, intended function, species requirements, structural considerations, and computational metrics and predictions, translating high-level goals into concrete design decisions. It spawns targeted computational experiments using Latent-X2, reasons about results, and doubles down on the most productive directions, adjusting generation parameters, modifying epitope constraints, or re-routing to alternative modalities as needed. Where standard capabilities are insufficient, the agent can generate custom computational approaches from natural language descriptions, extending its own toolkit to address novel design challenges, as described in Sec.˜2.3. Outputs annotated with the agent’s reasoning are produced at each stage for researcher inspection and, where needed, manual override. Before finalizing candidates, the agent performs quality assurance on the designs, including clustering for diversity, sequence similarity searches against external databases, and sequence liability analyses, selecting a final set of lab-ready designs that satisfy the user-defined objectives. Representative condensed reasoning traces illustrating fully autonomous and collaborative human–agent workflows are shown in Sec.˜2.2 and Sec.˜2.3 respectively.
At the level of an individual campaign, Latent-Y compresses the full computational antibody design workflow approximately 56-fold, on average reducing two weeks of expert effort to five hours, as shown in Fig. 1c. When a researcher runs multiple campaigns in parallel, these gains compound further still, multiplying the effective throughput of a single researcher beyond what any individual could achieve sequentially. The largest accelerations arise in the reasoning-intensive stages: literature review and PDB analysis (4,300) and structural analysis and epitope selection (350), as detailed in Fig. 1d. Baseline expert times were estimated by polling independent, PhD-level protein designers across academia and industry, with a median of 9.8 years of relevant experience, as described in App.˜D. These gains compound further at scale, with a single researcher able to complete in under a day computational work that would previously have taken several months, shifting drug design from a sequential expert workflow to a scalable parallel process limited by scientific ideas rather than time.
2.2 Latent-Yenables autonomous design of low nM-affinity antibodies
In the epitope discovery setting, we evaluate Latent-Y by running fully autonomous de novo VHH design campaigns against six therapeutically relevant targets, experimentally validating the resulting sequences in the wet lab, see Secs.˜2.1 and A.3. Campaigns were specified via natural language prompts, with prompts specifying only the high-level objective and leaving all design decisions to the agent. For the inhibition-focused campaigns, Latent-Y selected epitopes consistent with the intended mechanism of action, indicating that the agent reliably identifies functionally relevant binding sites from high-level goals alone. For IL-6R, given an unconstrained binding objective, the agent identified an epitope on domain 1 of the receptor ectodomain, a region absent from most co-crystal structures.
Successful campaigns produced experimentally confirmed VHH binders against three therapeutically relevant targets: IL-6 [undefv], an inflammatory cytokine; IL-6R [undefw], its receptor; and PRL [undefx], a hormone for which no antibody-bound structure exists in the PDB. Per-target hit rates ranged from , as determined by one-point high-throughput surface plasmon resonance (HT-SPR) primary screening, as shown in Fig. 1b and detailed in Sec.˜A.2. Latent-Y generated VHH binders with binding affinities reaching the single-digit nanomolar range, with the highest affinity binders for PRL, IL-6, and IL-6R measuring , , and , respectively, validated by five-point SPR, as shown in Sec.˜2.1 and detailed in Sec.˜A.3. For every target, high-affinity binders were identified from fewer than one plate of designs. Across targets with multiple confirmed binders, successful designs spanned a range of Complementarity-Determining Region (CDR) lengths and antibody frameworks, targeting distinct hotspot residues and reflecting the diversity of solutions explored by the agent. Lab-validated sequences for the best binder per target are provided in App.˜C. We publish the corresponding designed structures on https://platform.latentlabs.com, accessible without sign-in.
The IL-6 campaign is illustrated in Sec.˜2.2 as a representative, condensed reasoning trace of a successful campaign. Starting from a prompt specifying only the desired outcome, Latent-Y retrieved biological context from the literature and databases, identified an appropriate target structure, performed spatial reasoning over the target surface, selected candidate epitopes, and generated VHH binders using Latent-X2. Designed binders were iteratively triaged, with feedback from earlier cycles used to prioritize higher-yield strategies and propagate favourable features across subsequent cycles. This included prioritization of productive epitopes such as site II on IL-6 [undefy] and selection of antibody frameworks associated with high computational success rates. Through a final quality assurance, the agent determined when sufficient diversity and sequence quality had been achieved to satisfy the design objective. To our knowledge, this campaign produced the first experimentally validated fully de novo designed antibody binder against IL-6. While this trace illustrates one representative trajectory, the agent dynamically adapts each campaign based on intermediate results and user specifications, with every decision captured in the reasoning trace for full auditability.

2.3 Latent-Ydesigns cross-species antibodies via autonomous capability extension
To evaluate Latent-Y in a complex translational setting, we task the agent with designing cross-reactive VHH binders against the human and cynomolgus variants of TNF ligand superfamily member 9 (TNFL9), a co-stimulatory target under active clinical investigation in immuno-oncology. Cross-species reactivity is a common, but challenging, requirement in drug development: a candidate molecule must engage both the human target and its preclinical homologue to support toxicology studies and clinical dose selection.
This task combines several biological and practical challenges routinely encountered in early-stage drug discovery. The human and cyno orthologues diverge by 11 mutations (). No empirical structure is available for the cyno variant; there are unresolved regions in the available crystal structure for the human variant; and TNFL9 functions as a trimer with a relatively flat binding surface. Beyond these biological complexities, no pre-built cross-species design capability is provided to the agent. Instead, Latent-Y is given privileged but bounded access to the Latent Labs Platform and tasked with developing its own custom generative method guided only by a one-line natural language description, shown in Sec.˜2.3. A human expert works collaboratively with Latent-Y to provide high-level biological steering but does not otherwise intervene, demonstrating that the agent can be effectively directed without coding expertise. The campaign trace, condensed to its key moments for visual brevity, is shown in Sec.˜2.3.
Starting from a prompt specifying competitive disruption of TNFL9–TNFRSF9 binding, the human co-crystal structure (PDB 6A3V), and the cyno sequence alone, Latent-Y predicts the cyno trimer from sequence and aligns it to the human complex. The agent crops both structures to the relevant context, resolves disordered regions, and maps receptor-contact residues across species. Using dedicated subagents, it characterizes the binding interface and identifies candidate epitope configurations across the trimeric surface that remain minimally affected by the mutations between species. To enable cross-species generation, the agent implements a custom generative method using privileged platform access, translating the high-level request for a joint generation approach into working code without further instruction. The expert reviews the initial outputs to verify the underlying logic and provides targeted biological steering at key points. For example, the agent initially identifies hotspots that are geometrically accessible from the intra-trimeric side in silico, due to the crop, but biologically implausible. This is a form of reward hacking that human oversight identifies. Upon prompting, the agent imposes a geometric filter and redirects exploration toward single-chain configurations consistent with the desired binding stoichiometry. Latent-Y integrates each constraint, iterates over hotspot combinations, learns from evidence as more samples come in, and converges on tight three-region epitope configurations that produce dual-passing binders.
Within a set of 40 binders designed and selected for wet lab synthesis by the agent, HT-SPR screening identified three out of 40 binders as hits, exhibiting cross-reactive binding to both human and cyno TNFL9, as shown in Sec.˜2.3 and described in Sec.˜A.2. These results demonstrate that Latent-Y can autonomously translate a rough conceptual sketch into functional dual-target molecules, providing immediate starting points for affinity maturation.

2.4 Latent-Ytranslates scientific publications into antibody binders targeting the reported epitope
To evaluate Latent-Y’s ability to reason from scientific context alone, we benchmark the agent across 21 peer-reviewed publications, each describing a therapeutically relevant protein–protein interaction, as detailed in App.˜B. In this setting, all design information must be derived solely from the publication: the agent infers the biological context, mechanism of action, and the identity and structural location of the functionally relevant site to target directly from the text. The prompt only states the target protein name to avoid ambiguity for cases where multiple proteins discussed in a paper can be viable therapeutic targets. Each task uses a peer-reviewed publication as its sole input, mimicking the kind of scientific starting point that researchers encounter in practice, whether developing a work plan, drafting a grant proposal, or building on prior literature. Using published papers ensures that the scenarios are not hypothetical but reflect targets and interactions of genuine interest to the scientific community, drawn from leading journals including Nature, Science, Cell, and Proceedings of the National Academy of Sciences (PNAS).
As highlighted in App.˜B, the selected publications span diverse disease areas including oncology, immunology, inflammation, neuroscience, and metabolic disorders, and encompass a range of binding interactions to disrupt, including natural protein partners, natural peptides, non-antibody biologics, and computationally designed proteins. To prevent information leakage, we selected targets for which no Fab-, scFv-, or VHH-bound structure of the epitope specified in the source publication was available in the PDB as of 16 March 2026. This ensures that no antibody-specific structural information is accessible to the agent. Each campaign is evaluated under a uniform prompt, asking the agent to generate 24 computationally passing VHH binders within a sampling budget of designs, with the full prompt provided in App.˜B.
Across 21 campaigns, Latent-Y successfully identified the correct target epitope in 21 of 21 cases (), generated 24 or more passing binders before quality assurance (QA), as detailed in App.˜B, in 17 of 21 cases (), and delivered 24 or more passing binders after QA in 16 of 21 cases (), as shown in Fig. 2.4c. Further details are provided in App.˜B. The number of computationally passing binders accumulates non-linearly with total samples generated, frequently accelerating as campaigns progress and the agent refines its generative strategy, as shown in Fig. 2.4b. This pattern reflects the agent’s iterative explore-then-exploit reasoning: early batches probe diverse epitope, framework, and CDR length configurations, and once productive combinations are identified, the agent doubles down, rapidly accumulating passing designs. The agent completed the majority of campaigns well within the -sample budget, with a median budget consumption of approximately 4,600 samples across completed runs to reach 24 passing binders. Two out of 21 campaigns did not yield any passing binders within the specified budget. For the 19 campaigns that produced binders passing our computational filters, we show the design with the highest ipTM in Fig. 2.4a and the cumulative number of binders over the sample budget in Fig. 2.4b.
The hTfR1 campaign, targeting human transferrin receptor for blood–brain barrier crossing applications [undefz], was selected for experimental validation. Starting from a Science Translational Medicine publication describing Fc-mediated brain delivery [undefz], the agent inferred the relevant epitope from the published mechanism. To maximize the pool of candidates for experimental testing, this campaign was extended beyond the standard 10,000-sample budget, allowing the selection of 40 high-quality binders after QA. HT-SPR screening identified 11 of 40 tested designs as binder hits, as described in Sec.˜A.2, yielding a hit rate of , shown in Fig. 2.4a and Fig. 1b.
(a) Designed complexes of de novo VHH binders against 19 therapeutic targets for which Latent-Y found computational passes within a strict -sample budget, evaluated under a uniform prompt. Each VHH was designed based on context derived entirely from the text of a provided, peer-reviewed publication. The hTfR1 campaign (top left) was experimentally validated, yielding a binding hit rate of 11/40 as determined by HT-SPR. The remaining campaigns were not sent for experimental testing. (b) Number of computationally passing binders as a function of total samples generated across all 21 campaigns. (c) Agent reasoning and prompt fulfilment metrics across campaigns, showing success rates for correct epitope identification, generation of 24 or more passing binders before QA, and after QA, as described in App.˜B.
3 Methods
3.1 Latent-Y
Latent-Yis an agentic AI system [undefaa] built on frontier large language models as its reasoning engine, integrated natively with the Latent Labs Platform via a model context protocol (MCP, [undefab]) server that manages access to Latent-X2 inference, computational scoring, platform tooling, and the Latent Labs compute infrastructure. The agent harness is provider-agnostic; we evaluated several leading frontier LLMs and found performance to be robust across this variation, consistent with recent findings on frontier reasoning models [undefac, undefad, undefae]. The same harness can operate in tandem with general-purpose coding agent capabilities, further extending the agent’s action space, as demonstrated in Sec.˜2.3.
Effective context management is a central design principle of the harness, following recent findings on long-running agent systems [undefaf, undefag]. Specialized subagents handle distinct analytical tasks, for instance, a dedicated hotspot researcher subagent for target characterization and epitope analysis, and a quality assurance subagent for candidate evaluation, diversity filtering, and sequence liability analysis, with structured context hand-off between the orchestrator and subagents. The agent draws on standard bioinformatics utilities [undefah, undefai, undefaj, undefak], external APIs for biomolecular databases [undefal, undefam, undefan, undefao, undefap, undefaq] and scientific literature [undefar], and purpose-built tools for the specific demands of protein binder design campaigns. Users typically specify the desired modality — nanobodies, macrocyclic peptides, or miniprotein binders — directly in their prompt, though the agent can also evaluate and route across modalities autonomously based on epitope geometry, pharmacological requirements, and empirical model performance. System prompts encode accumulated drug design reasoning, guiding the agent towards productive strategies while preserving flexibility to adapt dynamically, reflecting findings that soft guidance outperforms rigid workflow specification for complex open-ended tasks [undefaf, undefas, undefat].
Latent-Y’s reasoning follows an explore-then-exploit pattern, spawning targeted computational experiments, reasoning over intermediate results, and concentrating resources on productive directions as campaigns progress, connecting to recent work on autonomous research agents [undefau, undefav, undefaw, undefax]. The agent can extend its own capabilities by generating custom computational methods from natural language descriptions when standard tools are insufficient, as demonstrated in Sec.˜2.3. Each campaign produces a complete reasoning trace capturing all decisions, tool calls, and strategy updates. Researchers can interrupt the agent at any point to inject biological context, override decisions, or redirect strategy, with the agent integrating these inputs and adapting its subsequent reasoning and operation accordingly.
3.2 Wet-lab methods
Binder screening and characterization followed a tiered workflow. A primary screen was performed using a one-point HT-SPR assay to identify candidates with measurable target binding, as in Sec.˜A.2. Designs exceeding the binding response threshold specified in Sec.˜A.2 were designated as hits. Hits from our primary screen that were advanced to determine were evaluated by five-point SPR, with affinities reported for binders meeting predefined criteria described in Sec.˜A.3.
4 Discussion
This work presents a significant milestone in computational drug discovery: the first autonomous agent for de novo biologics design with lab-validated results. Using text prompts expressing goals and constraints, Latent-Y delivers novel antibody sequences confirmed in the laboratory, demonstrating that the full workflow of an expert drug design campaign can be executed autonomously and without manual intervention. We regard this as a meaningful step towards the broader goal of an AI scientist for biology.
Across nine targets that span three qualitatively different campaign types, Latent-Y successfully produced lab-confirmed binders against six, achieving a target-level success rate with binding affinities reaching the single-digit nanomolar range. A particularly notable demonstration is Latent-Y’s ability to reason from scientific literature: given existing publications as input, the agent autonomously identified targets and epitopes, reasoned about published mechanisms of action, and designed binders accordingly. One such campaign was confirmed in the laboratory. The literature-inferred design benchmark further illustrates this at scale: 21 campaigns run in parallel, each seeded from a peer-reviewed publication describing a therapeutically relevant interaction, represent a volume of simultaneous scientific exploration that would be infeasible for any individual expert working alone. In user studies, experts working with Latent-Y completed design campaigns 56-fold faster than independent expert time estimates, compressing weeks of computational work into hours, with further gains achievable by running campaigns in parallel across multiple programs simultaneously.
Crucially, Latent-Y’s behaviour is not predetermined. Rather than executing a fixed workflow, the agent navigates each campaign adaptively, a property that connects to efforts toward autonomous AI scientists across scientific domains [undefav, undefau] and the emerging paradigm of autoresearch [undefaw]. Latent-Y contributes to this landscape with lab-validated results in therapeutic antibody design. Beyond adaptive reasoning within campaigns, Latent-Y can extend its own generative capabilities in response to novel design challenges. This is demonstrated by the cross-species campaign in which the agent implemented a custom generative method from a brief natural language description, yielding nanobodies that simultaneously bound human and cynomolgus homologues, confirmed in the laboratory. Reasoning traces are fully observable at every step, capturing each decision, tool call, and strategy update, providing the transparency and auditability that responsible deployment of autonomous agents requires. Current limitations reflect the performance of the underlying frontier LLMs, which we have evaluated across several leading models, the generative capabilities of Latent-X2 [undef], and the tools available to the agent. Laboratory and clinical validation of designed molecules remains essential. Latent-Y accelerates the computational stages of drug discovery but does not replace the experimental, confirmatory stages that must follow.
A question of central importance for AI scientists is whether they will produce truly novel scientific discoveries. Within the context of drug design, Latent-Y already delivers on this promise: every confirmed binder it produces is a novel molecule, designed de novo from a text prompt, that did not previously exist. The broader question of whether agents will uncover unexpected mechanisms or entirely new target biology remains an open and compelling frontier. Closing the loop with experimental feedback, expanding the agent’s action space, and ultimately integrating with fully robotic laboratories are promising directions. Extending laboratory validation to macrocyclic peptides and mini-binders, modalities the agent already supports, is a further natural direction.
Latent-Yand future versions stand to turn drug design into an increasingly computational discipline, making world-class molecular design expertise available to any researcher with a well-posed scientific question, and enabling drug-discovery organisations to operate at a scale and speed not previously possible. Latent-Y is available to selected partners at platform.latentlabs.com.
Contributors
Sebastian M. Schmon, Daniella Pretorius, Simon Mathis, Rebecca Bartke-Croughan, Aishaini Puvanendran, James Vuckovic, Henry Kenlay, Mária Vlachynská, Alex Bridgland, Ivan Grishin, Sven Over, David Li, Bridget Li, Jonathan Crabbé, Agrin Hilmkil**, Alexander W. R. Nelson*, David Yuan**, Annette Obika, Simon A. A. Kohl***
*** Corresponding author. E-mail:
simon@latentlabs.com.
** Work performed while at Latent Labs.
* Work performed as an advisor to Latent Labs.
Author contributions
Conceptualization and team leadership: S.K. conceived the research direction and priorities for applications, S.S., S.K. led the team and research. D.P. led the experimental design with contributions from R.B.C. and H.K. A.P. conceptualized and led user research studies, with contributions from D.P. and A.O. A.P., A.O. and A.N. contributed to project delivery and narrative.
Machine learning development: S.S., S.K. developed the agent, with contributions from H.K., S.M., A.B., J.C. and A.H.; J.V., A.B., S.O., A.H. and I.G. deployed and maintained computational infrastructure for model inference.
Platform infrastructure: S.S. developed the agentic platform
integration with contributions from A.H.
S.O., I.G., D.L. and S.S.
developed and maintained the agent platform infrastructure, including
front end and back end.
Computational design and evaluation: D.P., S.S., S.M. led
computational protein design workflows with contributions from H.K.,
B.L. and A.P.
D.P., R.B.C. and S.M. analysed experimental data. S.S., S.M., D.P.
performed computational benchmarking.
Experimental validation: D.Y., R.B.C. and D.P. oversaw internal and external validation. R.B.C. conducted internal experiments and contributed to experimental design. D.Y., D.P. and R.B.C. managed external laboratory partnerships.
Writing and figures: S.K. oversaw manuscript delivery. S.S., S.K., D.P., R.B.C., A.P. and S.M. wrote the manuscript. M.V., A.B., S.M., S.S., D.L. and A.P. made figures.
All authors contributed to the work and approved the final manuscript.
Competing interests
All authors have contributed as employees, contractors or advisors of Latent Labs Technologies Inc. or Latent Labs Limited.
References
- [undef] undef Latent Labs Team et al. “Drug-like antibodies with low immunogenicity in human panels designed with Latent-X2” arXiv:2512.20263 [q-bio] In arXiv arXiv, 2025 DOI: 10.48550/arXiv.2512.20263
- [undefa] undef Chai Discovery Team et al. “Drug-like antibody design against challenging targets with atomic precision” In bioRxiv Cold Spring Harbor Laboratory, 2025
- [undefb] Nabla Bio and Surojit Biswas “De novo design of epitope-specific antibodies against soluble and multipass membrane proteins with high specificity, developability, and function” In bioRxiv Cold Spring Harbor Laboratory, 2025, pp. 2025–01
- [undefc] John Jumper et al. “Highly accurate protein structure prediction with AlphaFold” In nature 596.7873 Nature Publishing Group UK London, 2021, pp. 583–589
- [undefd] Josh Abramson et al. “Accurate structure prediction of biomolecular interactions with AlphaFold 3” In Nature 630.8016 Nature Publishing Group UK London, 2024, pp. 493–500
- [undefe] Justas Dauparas et al. “Robust deep learning–based protein sequence design using ProteinMPNN” In Science 378.6615 American Association for the Advancement of Science, 2022, pp. 49–56
- [undeff] Joseph L Watson et al. “De novo design of protein structure and function with RFdiffusion” In Nature 620.7976 Nature Publishing Group UK London, 2023, pp. 1089–1100
- [undefg] Vinicius Zambaldi et al. “De novo design of high-affinity protein binders with AlphaProteo” arXiv:2409.08022 In arXiv, 2024
- [undefh] Martin Pacesa et al. “BindCraft: one-shot design of functional protein binders” bioRxiv preprint In bioRxiv Cold Spring Harbor Laboratory, 2024
- [undefi] undef Latent Labs Team et al. “Latent-X: An Atom-level Frontier Model for De Novo Protein Binder Design” arXiv:2507.19375 In arXiv, 2025
- [undefj] Thomas Hayes et al. “Simulating 500 million years of evolution with a language model” In Science 387.6736 American Association for the Advancement of Science, 2025, pp. 850–858
- [undefk] Tomas Geffner et al. “Proteina: Scaling flow-based protein structure generative models” In arXiv preprint arXiv:2503.00710, 2025
- [undefl] Hannes Stark et al. “BoltzGen: Toward Universal Binder Design” bioRxiv preprint In bioRxiv Cold Spring Harbor Laboratory, 2025
- [undefm] Protenix Team et al. “PXDesign: Fast, modular, and accurate de novo design of protein binders” In bioRxiv Cold Spring Harbor Laboratory, 2025, pp. 2025–08
- [undefn] Toshio Tanaka, Masashi Narazaki and Tadamitsu Kishimoto “IL-6 in inflammation, immunity, and disease” In Cold Spring Harbor Perspectives in Biology 6.10, 2014, pp. a016295 DOI: 10.1101/cshperspect.a016295
- [undefo] Violaine Bernard, Jacques Young and Nadine Binart “Prolactin — a pleiotropic factor in health and disease” In Nature Reviews Endocrinology 15.6, 2019, pp. 356–365 DOI: 10.1038/s41574-019-0194-6
- [undefp] Foo Yew Liew, Jean-Philippe Girard and Heth Roderick Turnquist “Interleukin-33 in health and disease” In Nature Reviews Immunology 16.11, 2016, pp. 676–689 DOI: 10.1038/nri.2016.95
- [undefq] Dominic Brenner, Henning Blaser and Tak W Mak “Regulation of tumour necrosis factor signalling: live or let die” In Nature Reviews Immunology 15.6, 2015, pp. 362–374 DOI: 10.1038/nri3834
- [undefr] Jun Lan et al. “Structure of the SARS-CoV-2 spike receptor-binding domain bound to the ACE2 receptor” In Nature 581.7807, 2020, pp. 215–220 DOI: 10.1038/s41586-020-2180-5
- [undefs] S Barillé, R Bataille and M Amiot “The role of interleukin-6 and interleukin-6/interleukin-6 receptor-alpha complex in the pathogenesis of multiple myeloma” In European Cytokine Network 11.4, 2000, pp. 546–551
- [undeft] Chao Wang, Gloria H Y Lin, Ann J McPherson and Tania H Watts “Immune regulation by 4-1BB and 4-1BBL: complexities and challenges” In Immunological Reviews 229.1 Wiley Online Library, 2009, pp. 192–215
- [undefu] Elena Gammella, Paolo Buratti, Gaetano Cairo and Stefania Recalcati “The transferrin receptor: the cellular iron gate” In Metallomics 9.10, 2017, pp. 1367–1375 DOI: 10.1039/c7mt00143f
- [undefv] Frits Rhee et al. “Siltuximab, a Novel Anti–Interleukin-6 Monoclonal Antibody, for Castleman’s Disease” In Journal of Clinical Oncology 28.23, 2010, pp. 3701–3708 DOI: 10.1200/JCO.2009.27.2377
- [undefw] Toshio Tanaka, Masashi Narazaki and Tadamitsu Kishimoto “Tocilizumab, a humanized anti-interleukin-6 receptor antibody, for treatment of rheumatoid arthritis” In Biomark Med 8.5, 2014, pp. 745–758 DOI: 10.2217/bmm.14.37
- [undefx] Stephanie Maciuba et al. “Discovery and characterization of prolactin neutralizing monoclonal antibodies for the treatment of female-prevalent pain disorders” In mAbs 15.1, 2023, pp. 2254676 DOI: 10.1080/19420862.2023.2254676
- [undefy] Just P Brakenhoff et al. “Development of a human interleukin-6 receptor antagonist.” In Journal of Biological Chemistry 269.1 Elsevier, 1994, pp. 86–93
- [undefz] Mihalis S Kariolis et al. “Brain delivery of therapeutic proteins using an Fc fragment blood-brain barrier transport vehicle in mice and monkeys” In Sci. Transl. Med., 2020
- [undefaa] Shunyu Yao et al. “React: Synergizing reasoning and acting in language models” In The eleventh international conference on learning representations, 2022
- [undefab] undef Anthropic “Model Context Protocol”, https://modelcontextprotocol.io, 2024
- [undefac] undef Anthropic “System Card: Claude Opus 4 & Claude Sonnet 4”, 2025 URL: https://www-cdn.anthropic.com/4263b940cabb546aa0e3283f35b686f4f3b2ff47.pdf
- [undefad] undef OpenAI et al. “GPT-4 Technical Report”, 2024 arXiv: https://arxiv.org/abs/2303.08774
- [undefae] undef Gemini Team et al. “Gemini: A Family of Highly Capable Multimodal Models”, 2025 arXiv: https://arxiv.org/abs/2312.11805
- [undefaf] undef Anthropic “Effective harnesses for long-running agents”, 2025 URL: https://www.anthropic.com/engineering/effective-harnesses-for-long-running-agents
- [undefag] undef Anthropic “Effective context engineering for AI agents”, 2025 URL: https://www.anthropic.com/engineering/effective-context-engineering-for-ai-agents
- [undefah] James Dunbar and Charlotte M Deane “ANARCI: antigen receptor numbering and receptor classification” In Bioinformatics 32.2 Oxford University Press, 2016, pp. 298–300
- [undefai] Martin Steinegger and Johannes Söding “MMseqs2 enables sensitive protein sequence searching for the analysis of massive data sets” In Nature Biotechnology 35.11 Nature Publishing Group US New York, 2017, pp. 1026–1028
- [undefaj] Stephen F Altschul et al. “Basic local alignment search tool” In Journal of Molecular Biology 215.3 Elsevier, 1990, pp. 403–410
- [undefak] Patrick Kunzmann and Kay Hamacher “Biotite: a unifying open source computational biology framework in Python” In BMC bioinformatics 19.1 Springer, 2018, pp. 346
- [undefal] undef UniProt Consortium “UniProt: a worldwide hub of protein knowledge” In Nucleic acids research 47.D1 Oxford University Press, 2019, pp. D506–D515
- [undefam] Helen M Berman et al. “The protein data bank” In Nucleic Acids Research 28.1 Oxford University Press, 2000, pp. 235–242
- [undefan] undef National Center for Biotechnology Information (NCBI) “PubMed [Internet]” Bethesda (MD): National Library of Medicine (US), 1996 URL: https://www.ncbi.nlm.nih.gov/Web/Search/entrezfs.html
- [undefao] James Dunbar et al. “SAbDab: the structural antibody database” In Nucleic Acids Research 42.D1 Oxford University Press, 2014, pp. D1140–D1146
- [undefap] Anna Gaulton et al. “ChEMBL: a large-scale bioactivity database for drug discovery” In Nucleic acids research 40.D1 Oxford University Press, 2012, pp. D1100–D1107
- [undefaq] Mihaly Varadi et al. “AlphaFold Protein Structure Database: massively expanding the structural coverage of protein-sequence space with high-accuracy models” In Nucleic acids research 50.D1 Oxford University Press, 2022, pp. D439–D444
- [undefar] undef National Center for Biotechnology Information (NCBI) “PubMed [Internet]” Bethesda (MD): National Library of Medicine (US), 1996 URL: https://pubmed.ncbi.nlm.nih.gov/
- [undefas] OpenAI Codex Team “Harness engineering: leveraging Codex in an agent-first world”, 2026 URL: https://openai.com/index/harness-engineering/
- [undefat] Amp Team “Context Management in Amp” URL: https://ampcode.com/guides/context-management
- [undefau] Juraj Gottweis et al. “Towards an AI co-scientist” In arXiv preprint arXiv:2502.18864, 2025
- [undefav] Ludovico Mitchener et al. “Kosmos: An ai scientist for autonomous discovery” In arXiv preprint arXiv:2511.02824, 2025
- [undefaw] Andrej Karpathy “autoresearch: AI agents running research automatically” In GitHub repository GitHub, https://github.com/karpathy/autoresearch, 2026
- [undefax] Peter Steinberger and undef OpenClaw Contributors “OpenClaw: Your own personal AI assistant” In GitHub repository GitHub, https://github.com/openclaw/openclaw, 2025
- [undefay] Chloe S. Adams et al. “De novo design of protein minibinder agonists of TLR3” In Nature Communications 16.1, 2025, pp. 1234 DOI: 10.1038/s41467-025-56369-w
- [undefaz] Erik Procko et al. “A Computationally Designed Inhibitor of an Epstein-Barr Viral Bcl-2 Protein Induces Apoptosis in Infected Cells” In Cell 157.7, 2014, pp. 1644–1656 DOI: 10.1016/j.cell.2014.04.034
- [undefaaa] Carin C. Stamper et al. “Crystal structure of the B7-1/CTLA-4 complex that inhibits human immune responses” In Nature 410.6828, 2001, pp. 608–611 DOI: 10.1038/35069118
- [undefaab] Anna Yui et al. “Mechanism of dimerization and structural features of human LI-cadherin” In Journal of Biological Chemistry 297.3, 2021, pp. 101054 DOI: 10.1016/j.jbc.2021.101054
- [undefaac] Daniel A. Bonsor et al. “Diverse oligomeric states of CEACAM IgV domains” In Proceedings of the National Academy of Sciences 112.44, 2015, pp. 13561–13566 DOI: 10.1073/pnas.1509511112
- [undefaad] Shirsha Saha et al. “Molecular basis of promiscuous chemokine binding and structural mimicry at the C-X-C chemokine receptor, CXCR2” In Molecular Cell 85.5, 2025, pp. 976–988.e9 DOI: 10.1016/j.molcel.2025.01.024
- [undefaae] Daniel Antfolk et al. “Molecular mechanism of Activin receptor inhibition by DLK1” In Nature Communications 16.1, 2025, pp. 5976 DOI: 10.1038/s41467-025-60634-3
- [undefaaf] Joseph Schlessinger et al. “Crystal Structure of a Ternary FGF-FGFR-Heparin Complex Reveals a Dual Role for Heparin in FGFR Binding and Dimerization” In Molecular Cell 6.3, 2000, pp. 743–750 DOI: 10.1016/S1097-2765(00)00073-3
- [undefaag] Kenneth Verstraete et al. “Structural insights into the extracellular assembly of the hematopoietic Flt3 signaling complex” In Blood 118.1, 2011, pp. 60–68 DOI: 10.1182/blood-2011-01-329532
- [undefaah] Naotaka Tsutsumi et al. “The structural basis for receptor recognition of human interleukin-18” In Nature Communications 5.1, 2014, pp. 5340 DOI: 10.1038/ncomms6340
- [undefaai] Guy P.. Vigers, Lana J. Anderson, Patricia Caffes and Barbara J. Brandhuber “Crystal structure of the type-I interleukin-1 receptor complexed with interleukin-1” In Nature 386.6621, 1997, pp. 190–194 DOI: 10.1038/386190a0
- [undefaaj] Xi Liu et al. “Structural insights into the interaction of IL-33 with its receptors” In Proceedings of the National Academy of Sciences 110.37, 2013, pp. 14918–14923 DOI: 10.1073/pnas.1308651110
- [undefaak] Weng Chuan Peng et al. “Structure of Stem Cell Growth Factor R-spondin 1 in Complex with the Ectodomain of Its Receptor LGR5” In Cell Reports 3.6, 2013, pp. 1885–1892 DOI: 10.1016/j.celrep.2013.06.009
- [undefaal] Paul H. Kussie et al. “Structure of the MDM2 Oncoprotein Bound to the p53 Tumor Suppressor Transactivation Domain” In Science 274.5289, 1996, pp. 948–953 DOI: 10.1126/science.274.5289.948
- [undefaam] Fabio Andres et al. “Inhibition of the MET Kinase Activity and Cell Growth in MET-Addicted Cancer Cells by Bi-Paratopic Linking” In Journal of Molecular Biology 431.10, 2019, pp. 2020–2039 DOI: 10.1016/j.jmb.2019.03.024
- [undefaan] Sonja Lorenz et al. “Structural Analysis of the Interactions Between Paxillin LD Motifs and -Parvin” In Structure 16.10, 2008, pp. 1521–1531 DOI: 10.1016/j.str.2008.08.007
- [undefaao] Shaogeng Tang and Peter S. Kim “A high-affinity human PD-1/PD-L2 complex informs avenues for small-molecule immune checkpoint drug discovery” In Proceedings of the National Academy of Sciences 116.49, 2019, pp. 24500–24506 DOI: 10.1073/pnas.1916916116
- [undefaap] Songtao Hu et al. “Structural basis for the immune recognition and selectivity of the immune receptor PVRIG for ligand Nectin-2” In Structure 32.7, 2024, pp. 918–929.e4 DOI: 10.1016/j.str.2024.03.012
- [undefaaq] Wei Yang et al. “Design of high-affinity binders to immune modulating receptors for cancer immunotherapy” In Nature Communications 16.1 Nature Publishing Group, 2025, pp. 2001 DOI: 10.1038/s41467-025-57192-z
- [undefaar] Longxing Cao et al. “Design of protein-binding proteins from the target structure alone” In Nature 605.7910, 2022, pp. 551–560 DOI: 10.1038/s41586-022-04654-9
- [undefaas] Carol A Rohl, Charlie EM Strauss, Kira MS Misura and David Baker “Protein structure prediction using Rosetta” In Methods in enzymology 383 Elsevier, 2004, pp. 66–93
\TitlefontSupplementary information
Appendix A Wet-lab methods
A.1 Cell-free protein production and purification
VHH constructs were expressed using an E. coli-based cell-free protein synthesis system. DNA sequences encoding each VHH were codon-optimized, synthesized, and subcloned into the pIVEX expression vector containing a C-terminal His-tag to facilitate affinity purification. Cell-free protein synthesis reactions were assembled by combining S30 cell lysate, synthesis buffer, required enzymes, and plasmid DNA in a 24-deep-well plate. Each reaction had a final volume of 5 mL and was incubated at 30°C for 6 hours. The reaction mixture was collected for purification. Proteins were purified using Ni-charged magnetic beads and dialysed into the desired buffer. The purified protein was filter-sterilised before storage. The concentration was determined by A280 protein assay, using a BSA standard. The protein purity was determined by standard SDS-PAGE confirmation. For this, samples were mixed with reducing loading buffer before running.
All target proteins and positive control proteins used in this study were commercially acquired as described in Sec.˜A.3.
A.2 Primary screening through high-throughput one-point SPR using Carterra LSA
Purified VHHs against all targets listed in Sec.˜A.3 (IL-6 [undefn], IL-6R [undefs], PRL [undefo], cTNFL9, hTNFL9 [undeft], hTfR1 [undefu], IL-33 [undefp], TNF [undefq], and SC2RBD [undefr]) were evaluated for binding using a high-throughput screen on the Carterra LSA platform. The assay was conducted at 25°C, with a Carterra LSA chip HC 200M and His capture kit. The His-tagged ligand was then injected. The analyte was diluted and injected over the surface for interaction analysis. All data were processed using Kinetics Evaluation Software. A reference channel and blank injections of running buffer were included in each cycle, serving as double references for the subtraction of resonance units (RU). For all targets, samples with > 100 were considered “hits”. For each target, the corresponding natural ligand was included as a target-level positive control to verify assay performance, as described in Sec.˜A.3.
A.3 Affinity determination by five-point SPR via Biacore 8K
For targets IL-6, IL-6R, and PRL, further biophysical characterization of hits identified by one-point SPR was performed with five-point SPR. The assay was performed at 25°C using Biacore 8K, with chip Series S Sensor Chip CM5 and an anti-histidine antibody kit for capture of the ligand. The His-tagged ligand was captured on the chip surface, and diluted analyte samples were injected as five-point concentration series, at a flow rate of 30 µL/min. Association and dissociation times were 120 s and 180 s.
The data were processed using Biacore 8K Evaluation Software (version 5.0). Sensorgrams were double-referenced using a blank reference surface and buffer-only injections to correct for nonspecific binding and bulk refractive index effects. Kinetic fitting was used. Fits were accepted based on a value of less than 10% of . Global fitting of data to a 1:1 model across the whole concentration series was used to determine , , and . For each target, the corresponding natural ligand was included as a target-level positive control to verify assay performance, as shown in Sec.˜A.3.
| Target Protein | Positive Control | ||||||
|---|---|---|---|---|---|---|---|
| Name | Vendor | Cat. No. | Species | Oligomer | Name | Vendor | Cat. No. |
| TNFL9 | Acro | 41L-C5254 | Cyno | T | TNFRSF9 | Acro | 41B-H53H3 |
| TNFL9 | Acro | 41L-H5269 | H.s. | T | TNFRSF9 | Acro | 41B-H53H3 |
| TNF | Sino | 10602-HNAE | H.s. | T | TNFR1 | Sino | 10872-H08H |
| hTfR1 | Acro | TFR-H5213 | H.s. | D | Transferrin | Acro | TRN-H52H3 |
| IL-33 | Sino | 10368-HNAE | H.s. | M | ST2/IL-1 RL1 | Sino | 10105-H08H |
| IL-6 | Sino | 10395-HNAE | H.s. | M | IL-6R | Acro | ILR-H4223 |
| IL-6R | Sino | 10398-H02H | H.s. | fD | IL-6 | Acro | IL6-H5243 |
| SC2RBD | Acro | SPD-C5255 | SARS-CoV-2 | fD | ACE2 | Sino | 10108-H08H |
| PRL | Acro | PRN-H5257 | H.s. | fD | PRLR | Acro | PRR-H52Ha |
Appendix B Literature-inferred design benchmark
For benchmarking prompt fulfilment when inferring targets and epitopes from literature context we employed a single standardized prompt that was accompanied by a PDF version of each publication listed in App.˜B:
I want to design 24 VHH binders to [TARGET_NAME], that target the function described in the technical paper. You may use a sampling budget of up to 10 000 samples. When you submit any batches for this campaign, please use the project_id=camp:xxx. \endlxSVG@picture
[TARGET_NAME] was substituted with the corresponding target name entry in App.˜B. Because most of the selected publications describe multiple potential targets, specifying a single target name allowed us to evaluate the agent’s ability to follow user-defined constraints, a prerequisite for reliable autonomous operation in a drug-discovery setting. The project_id=camp:xxx! called for the agent to use consistent project identifiers on the Latent Labs Platform, simplifying the benchmark analysis across the campaigns.
For hTfR1, the sampling budget was increased beyond the standard samples to allow for a larger number of computationally passing binders for wet-lab validation. All remaining 20 targets used the standard budget of samples as specified in the prompt.
Prompt fulfilment metrics. To quantify task completion, we evaluated each campaign against three prompt fulfilment criteria, summarized in Sec.˜2.4.
Correct epitope was assessed by comparing the epitope engaged by the designed binders against the functional epitope described in the source publication. A campaign was considered successful on this criterion if the agent identified and targeted an epitope consistent with the published mechanism of action.
Count met pre-QA and Count met post-QA measure whether the agent fulfilled the prompt’s request for 24 computationally passing VHH designs, before and after quality assurance, respectively. QA comprises automated sequence-level analysis applied to all candidate designs, including removal of duplicate sequences, sequence similarity search against The Structural Antibody Database (SAbDab) to confirm novelty, and detection of common liability motifs including N-linked glycosylation sequons and unpaired cysteines within CDR regions. A campaign was considered to have met the count criterion if at least 24 designs remained after each respective filtering stage.
Together, these three metrics characterize the agent’s ability to follow scientific instructions, reason about biological context, and deliver a sufficient quantity of high-quality, diverse candidates within a fixed computational budget—the core requirements for reliable autonomous operation in a drug-discovery setting. The full list of publications and targets is provided in App.˜B.
| Target | PDB ID | Publication Name | Therapeutic Area | Target Type | Type of PPI |
|---|---|---|---|---|---|
| TLR3 | 8YHT | De novo design of protein minibinder agonists of TLR3 [undefay] | Immunology | Toll-like receptor | Receptor: de novo minibinder, agonist |
| BHRF1 | 4OYD | A computationally designed inhibitor of an Epstein-Barr viral Bcl-2 protein induces apoptosis in infected cells [undefaz] | Oncology / virology | Viral anti-apoptotic protein | Protein:de novo minibinder, antagonist |
| CD80 | 1I8L | Crystal structure of the B7-1/CTLA-4 complex that inhibits human immune responses [undefaaa] | Immunology | Immune checkpoint | Receptor:Ligand |
| CDH17 | 7CYM | Mechanism of dimerization and structural features of human LI-cadherin [undefaab] | Oncology / gastroenterology | Cell adhesion molecule | Self-dimerization |
| CEACAM6 | 4YIQ | Diverse oligomeric states of CEACAM IgV domains [undefaac] | Oncology / immunology | Cell adhesion molecule | Protein oligomerization |
| CXCR2 | 8XVU | Molecular basis of promiscuous chemokine binding and structural mimicry at the C-X-C chemokine receptor, CXCR2[undefaad] | Immunology / inflammation | GPCR | Receptor:Ligand |
| DLK1 | 9D20 | Molecular mechanism of Activin receptor inhibition by DLK1 [undefaae] | Metabolism / myology | Secreted signaling protein | Receptor:Ligand |
| FGFR1 | 1FQ9 | Crystal structure of a ternary FGF-FGFR-heparin complex reveals a dual role for heparin in FGFR binding and dimerization [undefaaf] | Oncology | Growth factor receptor | Receptor:Ligand |
| FLT3 | 3QS7 | Structural insights into the extracellular assembly of the hematopoietic Flt3 signaling complex [undefaag] | Oncology / hematology | Receptor tyrosine kinase | Receptor:Ligand |
| hTfR | 6W3H | Brain delivery of therapeutic proteins using an Fc fragment blood-brain barrier transport vehicle in mice and monkeys [undefz] | Neurology / drug delivery | Transport receptor | Receptor:Fc fragment |
| IL-18 | 3WO4 | The structural basis for receptor recognition of human interleukin-18 [undefaah] | Immunology / inflammation | Cytokine | Receptor:Ligand |
| IL1R1 | 1ITB | Crystal structure of the type-I interleukin-1 receptor complexed with interleukin-1beta [undefaai] | Inflammation | Cytokine receptor | Receptor:Ligand |
| IL-33 | 4KC3 | Structural insights into the interaction of IL-33 with its receptors [undefaaj] | Immunology | Cytokine | Receptor:Ligand |
| LGR5 | 4BSR | Structure of Stem Cell Growth Factor R-Spondin 1 in Complex with the Ectodomain of its Receptor Lgr5 [undefaak] | Oncology / stem cell | Wnt pathway receptor | Receptor:Ligand |
| MDM2 | 1YCR | Structure of the MDM2 Oncoprotein Bound to the p53 Tumor Suppressor Transactivation Domain [undefaal] | Oncology | Oncoprotein | Signaling protein:peptide |
| MET | 6GCU | Inhibition of the MET Kinase Activity and Cell Growth in MET-Addicted Cancer Cells by Bi-Paratopic Linking[undefaam] | Oncology | Receptor tyrosine kinase | Receptor: bi-paratopic binder |
| PARVA | 2VZD | Structural Analysis of the Interactions between Paxillin Ld Motifs and Alpha-Parvin[undefaan] | Oncology / metastasis | Adhesion adaptor protein | Protein:protein (intracellular) |
| PD-L2 | 6UMT | A high-affinity human PD-1/PD-L2 complex informs avenues for small-molecule immune checkpoint drug discovery [undefaao] | Oncology / immuno-oncology | Immune checkpoint | Receptor:Ligand |
| PVRIG | 8X6B | Structural basis for the immune recognition and selectivity of the immune receptor PVRIG for ligand Nectin-2 [undefaap] | Oncology / immuno-oncology | Immune checkpoint receptor | Receptor:Ligand |
| TGFR2 | 8G4K | Design of high-affinity binders to immune modulating receptors for cancer immunotherapy [undefaaq] | Oncology / immuno-oncology | Cytokine receptor | Receptor:de novo minibinder |
| TrkA | 7N3T | Design of protein-binding proteins from the target structure alone [undefaar] | Neurology / oncology | Receptor tyrosine kinase | Receptor:de novo minibinder |
Appendix C Binder sequences
| Binder | (M) | Amino Acid Sequence |
|---|---|---|
| LY_VHH_PRL_77 | QVQLVESGGGLVQPGGSLRLSCAASAPSGYDLYFLDLGWFRQAPGQGLEAVAAINDFTGKTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCHADVLLVGKSDPDDIKKSSAWGQGTLVTVSS | |
| LY_VHH_IL6_67 | EVQLVESGGGLVQPGGSLRLSCAASQPFVSGMVMGWFRQAPGKGRELVAAIRTSDGSTYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAGTILPSSIPLSELTSDDFAYWGQGTQVTVSS | |
| LY_VHH_IL6R_32 | QVQLVESGGGLVQPGGSLRLSCAASLSSSDTFVYDLLGWFRQAPGQGLEAVAAIDPVSGATYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCMMRGGDGITGGSITYSDYWGQGTLVTVSS |
Appendix D Expert baseline estimation and agent comparison for computational protein design
To establish baseline timelines for computational protein design workflows, we conducted structured interviews with ten PhD-level computational protein designers across academia and industry, recruited based on direct experience with binder design campaigns using current computational methods including AlphaFold [undefc], RFdiffusion [undeff], Rosetta [undefaas], and commercial platforms. Participants had a median of 9.8 years of relevant experience since starting their PhD. Their relevant experience spanned a range of 5–15 years.
Interviews followed a task-decomposed protocol to mitigate planning fallacy, whereby individuals systematically underestimate time requirements for complex tasks. Rather than requesting a single aggregate estimate, participants first described their typical workflow in an open-ended fashion, then provided time estimates for each major stage of an epitope discovery campaign: literature review and PDB structure selection, structural analysis and epitope selection, computational binder generation, and quality assessment and candidate selection. Participants then validated their aggregate estimate against the sum of individual stage estimates. The reference scenario specified designing a binder against a therapeutic target from initial target specification through to validated candidates ready for experimental testing, based on each participant’s typical workflows, tools, and computational resources. Estimates reflected total elapsed time from the expert’s perspective, including time waiting for computational jobs to complete. Where participants indicated team-based workflows, estimates were adjusted to reflect individual person-hours.
For each workflow stage, participants provided minimum, typical, and maximum time estimates. Final reported values represent the mean typical estimate across participants, with error bars indicating the range from mean minimum to mean maximum. All participants provided informed consent prior to interview, including consent for audio recording and use of anonymized estimates in published research. Participant identities and affiliations were kept confidential.
Agent-assisted timelines were obtained from five fully autonomous design campaigns targeting IL-33, IL-6, MCL-1, PRL, and SC2RBD. For the PRL campaign, the agent immediately identified the correct epitope and PDB structure, resulting in near-zero time for literature review, structural analysis, and epitope selection. To avoid distorting the stage-level comparison, this campaign was excluded from those two stages but retained in the overall workflow timing and all other stages.
![[Uncaptioned image]](2603.29727v1/x1.png)