Phenylalanine modification in plasma-driven biocatalysis revealed by solvent accessibility and reactive dynamics in combination with protein mass spectrometry

Abstract

Biocatalysis is an emerging field that provides an environmentally friendly alternative to conventional catalysis, but still it faces some challenges. One of the major difficulties for biocatalysts that require reactive species like H2O2 as co-substrates lies in the concentration of these reactive species. On the one hand, they are used as reactants, but on the other hand, they inactivate the enzymes at high concentrations. When utilizing non-thermal plasma to deliver H2O2 for biocatalysis, it is essential to understand the potential interactions between plasma-generated species (PGS) and enzymes. This is particularly important because, alongside H2O2, other reactive species such as hydroxyl radicals, atomic oxygen, superoxide, and nitric oxide are also produced. The investigation of the localized reactivity of the solvent accessible surface area (SASA) of an enzyme, with certain species, is an important tool for predicting these interactions. In combination with reactive molecular dynamics (MD) simulations this enabled us to identify amino acid residues that are likely targets for modifications by the PGS. A subset of the theoretical predictions made in the present study were confirmed experimentally by mass spectrometry, underlining the utility of the SASA and MD based screening approach to direct time-consuming experiments and assist their interpretation.

UULM] Institute of Electrochemistry, Ulm University, Germany RUB] Applied Microbiology, Faculty of Biology and Biotechnology, Ruhr University Bochum, Germany UULM] Institute of Electrochemistry, Ulm University, Germany RUB] Applied Microbiology, Faculty of Biology and Biotechnology, Ruhr University Bochum, Germany RUB] Applied Microbiology, Faculty of Biology and Biotechnology, Ruhr University Bochum, Germany RUB] Applied Microbiology, Faculty of Biology and Biotechnology, Ruhr University Bochum, Germany UULM] Institute of Electrochemistry, Ulm University, Germany [KIT] Karlsruhe Institute of Technology (KIT), Germany [HIU] Helmholtz Institute Ulm (HIU) Electrochemical Energy Storage, Germany UULM] Institute of Electrochemistry, Ulm University, Germany [KIT] Karlsruhe Institute of Technology (KIT), Germany [HIU] Helmholtz Institute Ulm (HIU) Electrochemical Energy Storage, Germany MD

1 Introduction

Catalysis plays a pivotal role in our industrial world as most chemical syntheses only became feasible due to the development of appropriate catalysts. It contributes to the production of about 90 percent of all industrial chemicals ¹. However, conventional catalysis often has drawbacks, such as the use of harsh chemicals and the generation of heavy metal waste, for example.

Here, the emerging field of biocatalysis offers several advantages over classical catalysis. Enzymes as catalysts not only exhibit high efficiency, but they also can show remarkable specificity towards their substrates ². This reduces the need for downstream processing and minimizes waste production. The use of enzymes as catalysts not only benefits the environment, but also enables the production of specific chemicals on a smaller scale ^{3, 4}.

When using enzymes that work with co-substrates such as H2O2, ensuring a constant supply of reactive species at the right concentration remains a challenge in biocatalysis. These species are essential for fueling the catalytic reaction, but excessive amounts of reactive species can lead to enzyme inactivation limiting turnover rates ^{5, 6, 7}.

Several approaches have been tested to make biocatalysis a more competitive process compared to conventional catalysis. A recent review from H. L. Wapshott-Stehli and A. M. Grunde emphasises significant turnover numbers in different biocatalysis approaches highlighting the potential of biocatalysis for various applications ⁸. One innovative approach to address this challenge for H2O2 dependent enzymes is plasma-driven biocatalysis ⁹, which uses plasma-generated species (PGS) as reactants for the catalytic reaction. A plasma source, such as a capillary plasma jet (CPJ), a microscale-atmospheric pressure plasma jet (µAPPJ), or a dielectric barrier discharge (DBD) device, generates the desired concentration of reactants. The reactants are then transported into the liquid phase and therefore to the enzymes via the effluent of the plasma source. However, using a plasma source for in-line production is challenging because the reactive plasma species can alter and deactivate the enzymes. Therefore, it is crucial to understand the PGS-protein interactions. Recent research by Yacyi et al. provides valuable insights into the benefits of plasma species in biocatalysis. The authors came to the conclusion that a plasma-driven production of H2O2 can prove beneficial for the catalytic reactions, as it enables controlled inline production at the desired concentration ^{9, 10}.

(a)

(b)

(c)

Figure 1: 3D structural representations of the enzymes AaeUPO (PDB code: 5OXU) (a), CviUPO (PDB code: 7ZCL) (b) and GapA (PDB code: 7C5H) (c). Helices are shown in red, sheets in yellow, and turns and coils in green. The heme cofactor and the coordinating Mg ions in AaeUPO and CviUPO are shown in atomic representation using the standard atomic color coding (H: white, C: gray, N: blue, O: red, Fe: orange, Mg: green). The 3D representations were created with PyMOL ¹¹.

The present study seeks to elucidate the interactions between the plasma-generated species H2O2, OH, O2, O and NO and three enzymes of interest (see Figure 1) from an atomistic point of view, using mainly reactive molecular dynamics simulations. The PGS listed have been selected, since H2O2, OH, O2, O and NO occur at high densities in the plasma-effluent of the used dielectric barrier discharge plasma ¹². In addition to the other PGS, we included H which is not known to be generated by the plasma effluent but it could emerge from secondary reactions with the solvent. At this point it must be emphasized that the species modeled with reactive molecular dynamics are not real plasma-generated species. Due to the limitation of the method, these rmdPGS may differ slightly in their chemical behavior from the real species, a detailed explanation can be found in the SI (Section ”Explanation to the species nature in ReaxFF”5.2). We decided to investigate the enzymes AaeUPO, CviUPO and GapA. AaeUPO is a well studied unspecific peroxygenase and has been the model enzyme for plasma-driven biocatalysis. CviUPO is a promising alternative candidate, therefore the focus of this study lies on CviUPO as the main model enzyme. GapA is neither a nonspecific peroxygenase nor does it use H2O2 as a co-substrate. Instead, it is an enzyme involved in central metabolism that is known to be reversibly inactivated by H2O2. This, in turn, enables a comparison between the interaction behavior of an enzyme that is inhibited by H2O2 and those that actively utilize it. In our investigation, the interaction profiles of each species with the enzymes were screened using a solvent accessible surface analysis (SASA) approach. Subsequently, reactive molecular dynamics simulations were performed in order to verify possible PGS-induced modifications of the predicted residues. Further, the role of the surrounding solvent was addressed by performing these MD simulations both without and with the surrounding solvent. Finally, the simulation results were compared to mass spectrometry measurements of plasma-treated CviUPO, in order to validate the approach against experimental findings. The experimental analysis concentrates exclusively on CviUPO, as the glycosylation of AaeUPO complicates spectrometric analysis of this enzyme.

2 Computational details

All non-reactive molecular dynamics simulations in this work have been performed with GROMACS (version 2022.2 released June 16th, 2022) ^{13, 14, 15, 16, 17, 18, 19, 20, 21} and the latest version of the CHARMM force field, CHARMM36, for GROMACS (Updated July 2022) ^{22, 23, 24, 25, 26}. The non-reactive simulations were used for solvation and pre-equilibration of the enzymes. Prior to the simulations, hydrogen atoms were added to the X-ray structures of the enzymes to emulate neutral pH conditions. Afterwards, all proteins were solvated in cubic simulations boxes (80x80x80 Å) with periodic boundary conditions using the GROMACS solvation procedure, energy minimized and equilibrated by first a short run in an $NVT$ ensemble (100 ps), followed by an 100 ps $NPT$ run. Both, the $NVT$ and the $NPT$ runs had a position restrain on all enzyme atoms but hydrogen. Afterwards, a longer MD production run was performed for 1 ns at 300 K or any other desired temperature. The procedure follows the suggestions of J. A. Lemkul ²⁷. The hence prepared structures were then used as input for the reactive molecular dynamics simulations.
All reactive molecular dynamics simulations have been performed with the latest stable release of the LAMMPS simulation package (version August 2nd, 2023), ^{28, 29, 30, 31} employing a ReaxFF potential as originally developed by van Duin et al. ³². The ReaxFF force field used in this work is the biomolecule force field trained by Monti et al. in 2013 ³³. ReaxFF potentials allow dynamic bond breaking and formation by working with a concept of interatomic distances to determine bond orders, which are then used to compute the potential energy function. The time-integrated molecular dynamics simulations were conducted using a time step of 0.15 fs.
The SASA package for the interaction analysis is built on VMD ^{34, 35} for the determination of the solvent accessible surface area, and on the ReaxFF implementation of LAMMPS for the calculation of the interaction energies. The program first automatically converts the GROMCAS output file of an equilibrated protein into a LAMMPS data file, deleting the solvent molecule in the process, and then performs an energy minimization with the ReaxFF potential. Afterwards, all points on the protein surface that are accessible for the solvent (SASA points) are determined for the minimized structure by an interface to VMD ^{34, 35}. The distance of the SASA points to the protein surface is set to 1.4 Å per default, because its approximately the radius of water, the most commonly used solvent ³⁵. For the calculation of the interaction energy between the protein and a probe molecule, in our case the PGS, one probe molecule at a time is then placed at each of the SASA points. All probe molecules are initially rotated so that they are oriented horizontally to the nearest neighbor atoms of the protein. To find the optimal orientation of the probe molecule to the protein, a constrained energy minimization is performed, allowing the probe molecule to rotate, keeping the center of mass at its original position. At last, the program will run a final single point calculation. The resulting total energy $E_{\mathrm{SASA}}$ is used to calculate the local interaction energy at a specific SASA point $E_{\mathrm{int}}$ by subtracting the total energy of the protein $E_{\mathrm{macro\_mol}}$ and the total energy of the probe molecule $E_{\mathrm{probe\_mol}}$ (compare equation 1). The latter ones are calculated separately beforehand. All SASA calculations are performed in vacuum.

$$E_{\mathrm{int}}=E_{\mathrm{SASA}}-E_{\mathrm{macro\_mol}}-E_{\mathrm{probe\_mol}}$$ (1)

The method gives one interaction energy per SASA point, resulting in an interaction map around the enzyme showing regions of strong interaction (most negative values) and regions of weak interactions (less negative values). The package further provides two post processing methods, generating plots showing the protein residues and the atom types that are strongest interacted with. The residue analysis includes a calculation of the total interactions per residue and the relative interactions per residue. The relative interactions are calculated as follows:

$$Expected\,Interactions=\frac{Residue\,Count}{Total\,Residue\,Count}\cdot Interactions_{\mathrm{Total\,Number}}$$ (2)

$$Relative\,Interactions=\frac{Interactions_{\mathrm{Residue}}}{Expected\,Interactions}$$ (3)

For our analysis we defined the relative interactions as the quotient of the observed and and expected interactions. Per default the post processing functions only take into account the thirty strongest interaction energies. This cutoff value was determined empirically by analyzing the average number of data points required to cover the interaction energies of interest. The post processing functions strongly rely on the python API of the Ovito Open Visualization Tool ³⁶. The SASA package for the interaction analysis is available on GitHub ( https://github.com/hpoggemann/SASA-Analysis).

3 Experimental workflow

3.1 Enzyme preparation

The gene cviUPO was overexpressed in ZYM-5052 autoinduction medium using a pET21a(+) expression plasmid containing ampicillin resistance and an N-terminal His-tag. ³⁷ The plasmid was transformed into E. coli BL21 competent cells and cells were grown in LB medium containing 75 µg ml^-1 ampicillin at 37°C overnight. For overexpression, 10 ml of overnight culture were added into 1 L autoinduction medium with 75 µg ml^-1 ampicillin, 500 µM $\alpha$-aminolevulinic acid (Roth), and 200 µM hemin (Roth). Overexpression was performed at 16°C and 120 rpm for 5 days.
Cells were harvested by centrifugation and lysed by a homogenizer (pressure cell homogenizer SPCH-EP, Stansted) in lysis buffer containing 20 mM sodium phosphate, 500 mM NaCl, 10% glycerol, 0.2 mg ml^-1 DNase (Sigma), 0.2 mg ml^-1 RNase (Sigma), 0.35 mg ml^-1 lysozyme (Roth), and 2 mM complete protease inhibitor (Roche). After cell lysis, the lysate was centrifugated at 4°C and 21.000 $\times$ g for 60 min and the supernatant was filtered with 45 µm and 20 µm cut-off filters. Purification was carried out using the ÄKTA pure 25 system and a 5 ml HisTrap FF crude column (GE healthcare). Protein elution was performed using 4 column volumes of elution buffer B (20 mM sodium phosphate, 500 mM NaCl, 500 mM imidazole, pH 7.4). Proteins were eluted stepwise at 100 mM imidazole (20%), 200 mM imidazole (40%), and 500 mM (100%) imidazole in buffer B and fractions were collected in 1 ml steps, while fractions showing an absorption signal at 420 nm were united (heme-loaded protein).
After protein purification, dialysis was performed for buffer exchange in 5 L buffer A (20 mM sodium phosphate, 500 mM NaCl, 10% glycerol pH 7.4) overnight. Finally, a Bradford assay was used to determine protein concentration and heme loading of the enzyme was measured with UV-VIS spectroscopy (V-750 Spectrophotometer, Jasco), calculating the Reinheitszahl ($r/z$-value; A₄₂₀/A₂₈₀) of purified enzyme.

3.2 Plasma treatment

To assess the influence of plasma on CviUPO, a dielectric barrier discharge (DBD, Cinogy,) source was used for plasma treatment. To this end, 40 µl enzyme (1 mg ml^-1 CviUPO) were placed onto a metal plate and treated with the DBD for 5 min (electrode diameter 20 mm; 13.5 kV pulse amplitude; 300 Hz trigger frequency; 1 mm distance to sample). The treated samples were transferred to a reaction tube by centrifugation (2,000 $\times$ g for 1 min). The samples were stored at $-70$°C until mass spectrometrical analysis. Untreated protein used as control underwent the same procedure but was not exposed to plasma.

3.3 Mass spectrometry of CviUPO

For mass spectrometry (MS) analysis, the protein samples were reduced, alkylated, and then digested with trypsin. For this purpose, 0.1% RapiGest (Waters) and 2.5 mM tris-(2-carboxyethyl) phosphine hydrochloride were added to 1 mg ml^-1 enzyme sample and made up to 60 µl total volume with A. dest.. The samples were then reduced at 60°C for 45 min. After addition of 5 mM iodoacetamide, the samples were incubated again at 25°C for 15 min in the dark for alkylation. For tryptic digestion, 0.5 µg trypsin (0.5 µg µl^-1 stock solution) were added prior to incubation at 37°C and 300 rpm for 5 h. To precipitate RapiGest, 1 µl trifluoroacetic acid (TFA; concentrated) was added and the samples were centrifuged at 10,000 $\times$ g and 4°C for 10 min. The supernatant was transferred to a new reaction tube and the procedure was repeated until no more pellets were visible. For the MS measurement, samples were diluted to a concentration of 0.25 µg µl^–1 in 5% acetonitrile with 0.1% TFA (total volume 20 µl) and 2 µl of sample (0.25 µg/µl) were injected to an ACQUITY UPLC M-Class System (Waters), equipped with an nanoEase m/z peptide CSH column (Waters, particle size 1.7 µm, column size 0.3 x 100 mm) and eluted online to a Synapt XS (Waters) mass spectrometer equipped with an ESI source and a low flow probe (Waters). Peptides were eluted using a gradient of 0.1% formic acid (FA) in MS grade A. dest. (solvent A) or acetonitrile (solvent B) with a flow rate of 7 µl/min: 0-3 min, 1% B; 3-100 min, 35% B; 109 min, 90% B; 110 min, 90% B; 115 min, 1% B; 120 min, 1% B. The column temperature was set to 40 °C and MS^E spectra were recorded from 50-2000 m/z in positive resolution mode with a scan time of 0.7 s. Argon served as collision gas with a collision ramp of 17-60 V. The following parameters were used: capillary voltage 2.5 kV, cone voltage 40 V, source offset, 4 V; cone gas flow 50 L/h, desolvation gas flow 500 L/h, source temperature 80 °C, desolvation temperature 250 °C. Glu-1-fibrinopeptide B was recorded as lock mass. To analyze the spectra of CviUPO peptides, ProteinLynx Global Server (Version 3.0.3, Waters) was used to detect protein modifications using a Escherichia coli BL21 database (Uniprot UP000002032) containing the sequence for rCviUPO. The amino acid sequence of the rCviUPO used in this study is provided in the supplementary information (Figure 1). The His-tag attached to the protein was not considered in the numbering of amino acid positions, resulting in a 21 position shift when compared to the full-length sequence that includes the His-tag. The chromatographic peak width and MS TOF resolution for MS spectra analysis was set to automatic, lock mass for charge 2 was set to 785.8426 Da/e and the lock mass window was set to 0.25 Da. The low energy threshold and elevated energy threshold were specified as 50.0 counts and 25.0 counts, respectively. Peptide tolerance and fragment tolerance were selected as automatic, minimal fragment ion matches per peptide was 3, minimal fragment matches per protein was 7, and minimal peptide matches per protein was 1. The maximal protein mass was set to 250 kDa and primary digest reagent was trypsin. For modification analysis, up to one missed cleavage per peptide was allowed and the false discovery rate was set to 1. Spectra were processed and searched for the following modifications: carbamidomethylation of cysteine (delta mass +57.0215 Da), which was defined as fixed modifier reagents; oxidation of methionine (delta mass +14.0157 Da), double and triple hydroxylation of cysteine (delta mass +31.9988 Da and +47.9982 Da), single hydroxylation of phenylalanine (delta mass +15.9994 Da), dehydrogenation of arginine (delta mass -4.0316 Da), dehydrogenation of lysine (delta mass -4.0316 Da), hydroxylation and dehydrogenation of lysine (delta mass -3.0468 Da). All modifications were defined as variable modifications.

4 Results and Discussion

4.1 SASA interaction analysis

4.1.1 CviUPO

The SASA interaction analysis was performed for the rmdPGS H2O2, OH, O2, O, NO and H. Figure 2 shows only the results for H, OH and H2O2 interactions, data for the other species can be found in the supplementary information (Figure 2 – 5).

Figure 2: Interaction profiles from SASA for the enzyme CviUPO at 300 K. (a), (b) and (c) show the interaction maps with H, OH and H2O2, respectively. The bar plots below show the relative and total interactions per amino acid, heme cofactor (Heme), the coordinated Mg ion (Mg), and Cym cysteine group bound to the heme center, which differs chemically from a Cys with a free thiol, and is therefore highlighted separately.

Panel (d) corresponds to the interactions with H, (e) and (f) show the interactions with OH and H2O2 respectively. The computational details provide a detailed explanation of the SASA procedure.

Comparing Figures 2 (a), (b) and (c) it is apparent that H has the least negative interaction energy, which means that the interactions with H are weaker than with OH or H2O2, for example. H shows the strongest interaction with glutamic acid (Glu) and aspartic acid (Asp) residues both in absolute and relative terms (Figure 2 (d)). Both of these residues are negatively charged at neutral pH and in the simulations and can act as proton acceptor residues ². OH shows the strongest absolute interactions with lysine (Lys), followed by phenylalanine (Phe) and arginine (Arg). When taking into account the frequency of each amino acid occurring in textitCviUPO (relative interaction plot in 2 (e)), Lys interactions are the most frequent followed by histidine (His), Asp, Glu and Phe. Lys and Arg are known to be proton donor residues, which makes these amino acids attractive for OH and other negatively charged PGS. Phe is one of the most frequent amino acids in CviUPO and also exposed on the outside of the protein, which could explain strong interactions. Also OH radicals are known to form adducts on the aromatic ring ³⁸. OH also shows a nearly inverse local interaction profile to H, which is expected since H is positively charged and OH occurs either as a radical species or as a negatively charged ion. H2O2 on the other hand does display a less locally pronounced interaction profile. Most of the protein surface seems to be equally attractive for this species, except for some sampling points inside the reactive channel. In absolute terms, H2O2 interacts strongly with serine (Ser) and also with Glu, followed by Lys. When accounting for amino acid frequency (relative values) His, ASn and Ser interact most frequently with H2O2. Ser is a polar but uncharged amino acid and it has proton donor as well as acceptor atoms, which could favor an interaction with an ambivalent molecule, such as H2O2. O exhibits a similar interaction profile to OH, with the highest number of interactions occurring with Lys, followed by Arg (Supplementary Figure 5 (d)). NO interacts strongly with aspartic acid (Asp), which is negatively charged and often acts as hydrogen acceptor residue (Supplementary figure 4 (d)). Furthermore, NO interacts often with Lys, as well as Glu and leucin (Leu). Leu similar to Phe has no tendency to act as a hydrogen acceptor or donor, nevertheless there are frequent interactions with this residue. That can be explained by the fact that Leu is the most frequent amino acid in CviUPO. The most dominant interaction partner of O2 is Lys, followed by Arg, Leu, isoleucine(Ile), tyrosine (Tyr) and valine (Val), all with an equal amount of total interactions in the SASA analysis (see Figure 5 (a) in the SI). All tested rmdPGS interact strongest with charged or polar residues of the enzyme, which is the expected behavior. But charge is not the only criterium for interaction. The position of the amino acid is also of importance, as is the total frequency of occurrence of the amino acid in the enzyme. Residues such as Leu or Lys, which appear often and are exposed on the outside of the protein, are more likely to have many interactions with the rmdPGS and are therefore also more likely to be modified under experimental conditions. The analysis shows no strong tendency of neither the rmdPGS interact with cysteine (Cys) nor methionine (Met), even though other studies found sulfur-containing amino acids to be strongly modified by the plasma ^{39, 40, 41}. One possible explanation for this behavior might be that neither Met nor Cys appear frequently in CviUPO (Met only five times and Cys only two times). Also all seven residues are buried in the protein structure and not at the solvent accessible surface area. Furthermore, there is one free thiol available, because one of the two Cys is bound covalent to the heme center (Cym). In addition, not all species seem to be equally prone to interacting with the active pocket. Only H2O2 and O2 have strong interactions with residues close to the heme center. H2O2 interacts with a Lys (Lys165) and a Glu (Glu162) residue while O2 interacts with Ile (Ile61), the same Lys residue (Lys165), as well as an hydrogen atom from the heme center. Both the potential removal of a hydrogen atom from the heme center and alterations in Glu162 or Lys165 could be detrimental to the catalytic process. Given that catalysis primarily occurs at the heme center and both of these amino acids play an active role in the catalytic mechanism of CviUPO, their integrity is crucial for enzymatic function ⁴². In the CviUPO reaction cycle Glu162 serves as a hydrogen acceptor and Lys165 supports the stabilization of the intermediates.

Figure 3: 3D representations of CviUPO (left) and SASA interaction profile (right) for OH at different temperatures: (a) at 300 K, (b) 400 K, and (c) at 500 K. The SASA procedure and analysis are consistent with those, used to generate the previous figure. The 3D representations were generated using PyMOL ¹¹, with input structures derived from the output of the equilibration simulations at the specified temperatures. For a detailed description of the SASA methodology, refer to the computational details in the methods section.

The interaction profiles change when the temperature rises and the protein begins to unfold. The exact denaturation temperatures are different from enzyme to enzyme, but most of them are inactivated at temperatures above 60 °C (338,15 K). Theoretically, higher test temperatures up to 350 K could also be sufficient. However, proteins in MD simulations do not always behave identically to those in experiments. Additionally, fluctuations in thermostats during simulations often range between 10 K and 20 K. Therefore, alongside 300 K, two higher temperatures — 400 K and 500 K — were tested. These temperatures are extremely high by experimental standards, ensuring that the protein is at least partially unfolded at 400 K and fully denatured at 500 K. The results for OH at 300 K, 400 K and 500 K can be found in Figure 3. For the other species the results can be found in the supplementary information (Supplementary Figure 3 to 5). Figure 3 already indicates some differences in behavior at 300 K and 400 K. The most notable observation is the decrease in interactions with Lys and Phe at 400 K, accompanied by an increase in interactions with Arg and Asp. This shift may be attributed to the initial stages of enzyme unfolding, which likely exposes charged amino acids more to OH, thereby enhancing the likelihood of interaction. The unfolded protein at 500 K has a greater surface area, exposing even more amino acid residues for potential interactions. But the overall interaction profile of OH is consistent with the lower temperatures. For the other tested rmdPGS this is not necessarily the case. With increasing temperature most of the rmdPGS display a shift in their interactions towards protein residues which have been protected by the surrounding structure before, like the heme center (Supplementary Figure 3 to 5 in the SI). Overall, higher temperatures appear to increase the chance of fatal modification on crucial parts of the enzyme, as key residues become more exposed to reactive species.

To validate whether the rmdPGS really react with the protein in the predicted position those ten SASA points, that have the lowest interaction energies, were investigated in detail (the precise coordinates and the corresponding amino acids for each point are listed in supplementary Table 1). After an initial energy minimization, a short MD simulation of 75 fs was performed in order to check whether chemical reactions occur. This brief time period was selected to prevent the probe molecule from diffusing to locations other than the predicted position, ensuring that interactions occur specifically at the predicted sites. The simulations were conducted for all rmdPGS at 300, 400, and 500 K in vacuum as well as in the solvent phase. None of the vacuum simulations showed an immediate bond formation between the rmdPGS and the protein during the energy minimization step. Apart from a few exceptions, after 75 fs only H, O and OH form bonds to the enzyme at the predicted positions with the high interaction energies. Of the 10 positions tested, hydrogen binds in eight positions at 300 K, while oxygen binds in seven and OH and NO in only five and one of the tested positions, respectively (compare Supplementary Table 1). Naturally, H binds to oxygen, while O and OH only bind to hydrogen atoms. The detailed results of this analysis are provided together with the simulation data in addition to the paper. This result is consistent at all three tested temperatures. The other rmdPGS tend to associate at the protein surface but they do not form covalent bonds to one of the protein atoms. In the solvent simulations, only few bonds are forming between the protein and the rmdPGS in this short time period (compare Supplementary Table 2 in the SI). Most of the species do not react with the protein in the predicted position but rather interact with the solvent molecules. This is a trend that also continues with longer simulations that allow diffusion (see Section Interactions with high rmdPGS concentrations4.2).

This validation shows that the algorithm is indeed able to predict the positions of the protein surface that are most likely to be modified by rmdPGS binding, but a high interaction energy at a particular position does not automatically mean that a rmdPGS will bind there. A subsequent verification is always recommended.

4.1.2 Comparison to AaeUPO and GapA

To broaden the scope of our investigation, the interaction analysis was also performed for AaeUPO, which is a model enzyme for H2O2-dependent biocatalysis, and for GapA. GapA is a glycolytic enzyme, that does not have a heme center, but uses a cysteine thiol group as its catalytic center instead. While H2O2-based heme poisoning is a common problem of peroxidases, GapA is inactivated reversibly in an H2O2-dependent fashion by formation of an intramolecular disulfide bond which engages the catalytic cysteine. Figure 4 shows the comparison of the OH interactions with the three enzymes. Similar to Figure 2 the interaction maps are displayed in the upper panels and the interactions with amino acids in the lower panels. The interactions of the other tested species can be found in the supporting information (Supplementary Figure 6 to 9).

Figure 4: Comparison of the SASA interaction map of OH at 300 K between (a) CviUPO, (b) AaeUPO, and (c) GapA. The diagrams underneath show the respective residue interactions. The SASA procedure and analysis were performed as described above, and methodological details are provided in the computational Details section.

Even though the three enzymes are differently-shaped, the interactions with the rmdPGS follow similar trends. For all three enzymes OH shows strong interactions with Arg. The main difference is the strong interaction of OH with Lys and Phe in CviUPO. In AaeUPO OH has moderate interactions with Phe but not with Lys, whereas the opposite pattern is observed for GapA, where OH interacts to some extend with Lys but not with Phe. However, AaeUPO shows few strong interactions at Lys also with the other reactive species, such as O2 (Supplementary Figure 4 (e)), likely because Lys occurs less frequently in AaeUPO than in CviUPO, which can be clearly seen in the relative data. The same argument applies to GapA, Phe less abundant this enzyme compared to CviUPO. While the interaction partners for H are almost identical for all three enzymes, the interactions with H2O2 show some variation between the proteins. In AaeUPO, H2O2 interacts most strongly with Arg and Asp in absolute and Trp in relative terms, whereas in GapA, the strongest interactions are observed with Arg, threonine (Thr) and His. The His interaction is even more pronounced in the relative representation. These differences are probably related to the different shapes and compositions of the proteins. GapA has far more beta sheets in its protein structure, of which Thr is a central component, making it easier to access. The NO and O results are again similar for all three proteins, with Glu being targeted by NO and Arg and Lys interacting with O. Furthermore, NO interacts with only few residues in GapA when compared to AaeUPO and CviUPO. This might suggest that GapA has a low affinity for NO and that it is well protected from modifications by these species, but this would need to be confirmed experimentally. O2 interacts most strongly with Arg and Lys in CviUPO and GapA. In contrast, for AaeUPO, the strongest interactions are with Arg, Leu, Phe, and Glu. H and NO have the least overall interaction with the surface of the different enzymes. Of course, there are certain sites that interact strongly with these species, but overall there are fewer interactions than with the other species tested.
Similar to CviUPO, for AaeUPO only two interactions with low energy are detected near the heme center. Both are interactions with H2O2, one with Glu196 and the other with Phe199. For GapA H2O2, O2, OH and O are the species most prone to interact with the reactive center, indicated by the low energy interactions in the active pocket. They all interact with Thr152 and Gly210, but only O2 has a high interaction energy with a hydrogen atom ($\mathrm{HN_{2295}}$) from the reactive cysteine group Cys150.

The result emphasizes that the species important for catalysis, e.g. H2O2 and O2, are pulled towards the active site in all three enzymes, but in comparison, the number of interactions at the active site is lower than at other positions on the protein surface. This is partly due to the fact that there is only one reactive center in each of the enzymes studied, so the probability of interaction with this center is lower than with the more abundant residues of the enzyme. Moreover, the reactive center of the protein is less accessible than the amino acids on the protein surface.

With increasing temperature, the interactions of the rmdPGS with AaeUPO and GapA change in a similar way as for CviUPO. The residues with the most interactions change slightly because new interaction spots are available when the protein starts unfolding. Therefore, the change between 300 K and 400 K is small, because the proteins are still quite stable at these temperatures. However, at around 500 K, the proteins lose their structure and shape, resulting in a more pronounced change in the interaction profile. Interestingly, CviUPO and GapA have the most positions with a favorable interaction energy in the active pocket at 400 K. At 500 K the active pocket has fully collapsed due to the unfolding and access pathways to the active center are blocked. AaeUPO on the other hand shows the most interactions within the active pocket at 500 K. The short validation MD simulations of the predicted positions in AaeUPO and GapA also showed similar results to CviUPO. In vacuum, mostly H, O and OH instantly react with the enzymes at the predicted positions (compare Supplementary Tables 3 – 4 in the SI). The hydrogen atoms bind to an unsaturated oxygen atom, while O and OH abduct hydrogen atoms from the protein. This behavior is independent of the tested temperature. In the solvent we also observe identical behavior as for CviUPO. Most rmdPGS rather interact with the solvent than with the proteins.

4.2 Interactions of CviUPO with high rmdPGS concentrations

Under experimental conditions the rmdPGS will not diffuse towards the enzyme systematically, but rather via random diffusion from the interface of the plasma (DBD) or the effluent (µAPPJ, CPJ) with the liquid through the solvent to the protein. To approach more realistic conditions we performed MD simulations with a high concentration of rmdPGS in a random configuration around the enzyme. These simulations are intended to serve as an extended proof of concept for SASA fast screening approach. The simulations were performed at different temperatures (300 K, 400 K and 500 K) and repeated 3 times with different random orientations of the rmdPGS. The total simulation time for these simulations was 75 ps with a 0.15 fs time step. Additionally, they were conducted in vacuum and in solvent. The results for the interactions of 100 OH atoms with CviUPO are display in Figure 5, the other species can be found in the SI (Supplementary Figure 10 to 14).

i Without solvent

ii With solvent

Figure 5: Bond analysis for high concentrations of hydrogen with CviUPO. All panels show the total number of bonds to an additional OH atom per residue and the relative interactions calculated following equation 3. The legend is equivalent to that in the previous graphs. The panels (a) and (d) show the interactions at 300 K, without and with solvent, respectively. The panels (b) and (e) show the interactions at 400 K and the panels (c) and (f) show the interactions at 500 K. All simulations were conducted as described at the beginning of this section as well as in the Computational Details section.

Figure 5 (a) shows that in absence of solvent OH is binding frequently to Lys, Phe and Arg at 300 K, which aligns with the SASA predictions (see Figure 3. At higher temperatures this trend continues and as predicted by the SASA analysis the interactions with Gln increase (Figure 5 (b) and (c)). For the other rmdPGS, the predictions also agree well with the MD simulation results. The favored interaction partners for H are still Glu and Lys (Supplementary Figure 10) and O has nearly identical interactions in the simulations and the SASA prediction (Supplementary Figure 14) . H2O2 has less interactions with Ser and Glu than expected based on the SASA analysis, in contrast to that Arg has more interactions especially at 500 K (Supplementary Figure 11). Similar to the other rmdPGS NO has the most interactions with Lys, but Asp and Glu show less interactions compared to the prediction from the SASA analysis (Supplementary Figure 12). Interestingly, with rising temperature this deviation decreases. For NO the total interactions per residue are again similar, but Tyr and Val do not have as many interactions in the MD simulation results. The only outlier appears to be O2, but O2 has only few interactions with the enzyme in the MD simulations that it is difficult to compare with the prediction (Supplementary Figure 13). Overall, the ratio and trend of the favored amino acids stay highly similar within the observed temperature range, which also emphasizes the great correspondence to the SASA prediction.
The trend from the simulations without solvent is also visible in the simulations with solvent (Figure 5 (d)-(f)), despite the high errorbars. A detailed analysis of the newly formed bonds involving the additional OH revealed that, in the solvent simulations, the majority react with the solvent rather than with the enzyme surface. This is in accordance with the short validation simulations from Section ”SASA interaction analysis CviUPO”4.1. The surrounding water molecules protect the enzyme from being modified by the rmdPGS.
The solvent simulations with the other rmdPGS also follow the trend from the SASA predictions (compare Supplementary Figures 10 to 14). However, this observation should be taken with care, because of the relatively large error bars. The analysis of the high concentration simulations emphasizes that not only properties of the protein surface play a role but also the initial position and the diffusion pathways of the rmdPGS towards the protein.
Some differences between the SASA predictions and the MD simulations are expected, as the SASA method works with predetermined points and only considers the most favorable interactions, while the MD simulations work with a fixed concentration of rmdPGS in a random distribution. However, the reliability of the SASA prediction is encouraging.
To achieve more reliable statistics, this type of simulation would need to be repeated more often with varying initial conditions. While this approach would improve statistical accuracy, it is also highly time-intensive. Given that the trends observed in these simulations align with the SASA results, the SASA method is certainly an interesting rapid approach for a fast screening of protein-plasma interactions.

The same behavior can also be observed with the enzymes AaeUPO and GapA, a detailed description of their interaction can be found in the SI.

4.3 Mass spectrometry of plasma-treated CviUPO

In order to investigate the interactions of amino acids of the CviUPO with PGS, the rCviUPO was treated with the DBD for 5 min and was then digested with trypsin for MS measurements. Beside Met and Cys, the amino acids Phe, Arg, and Lys were chosen for the modification analysis because of their predicted strong interaction with ROS such as OH (SASA interaction analysis). Initially, only reactions with ROS and not with RNS were investigated experimentally. The mass spectrometrical analysis showed highly significant oxidation of Phe51, Phe67, Phe208 (Phe+O), Met42, and Met220 (Met+O) in all three replicates after 5 min of plasma treatment (Table 1).

Table 1: Amino acid residues of CviUPO oxidized by plasma treatment. For plasma treatment, 40 µl of rCviUPO (1 mg ml^-1) were applied to a metal plate and treated with DBD plasma for 5 min (electrode diameter 20 mm; 13.5 kV pulse amplitude; 300 Hz trigger frequency; 1 mm distance to sample). Protein samples were collected, reduced with TCEP, alkylated with iodoacetamide, and digested with trypsin for LC-MS/MS measurement. Five amino acid residues were found to be oxidized by plasma treatment. The average relative intensities of the peptides containing these five amino acids in unmodified form (bold, black) or oxidized (bold, red) in untreated controls and plasma-treated samples are shown sorted by the starting position of the peptide (N=3). Modifications were detected in all three replicate experiments with relative intensities $>$100. n.d.: not detected.

Amino acid	Starting pos.	Peptide nr.	Peptide sequence	Average relative intensity (Control)	Average relative intensity (Plasma)
Met42	33	1	DGRNITVAMLVPVLQEVFHLSPELAQTISTLGLFTAQDPSK	21	2254
	33	2	DGRNITVAMLVPVLQEVFHLSPELAQTISTLGLFTAQDPSK	552	24
	36	3	NITVAMLVPVLQEVFHLSPELAQTISTLGLFTAQDPSK	32	417
Phe51	36	1	DGRNITVAMLVPVLQEVFHLSPELAQTISTLGLFTAQDPSK	19	590
	33	2	DGRNITVAMLVPVLQEVFHLSPELAQTISTLGLFTAQDPSK	n.d.	24
Phe67	33	1	DGRNITVAMLVPVLQEVFHLSPELAQTISTLGLFTAQDPSK	3	265
	33	2	DGRNITVAMLVPVLQEVFHLSPELAQTISTLGLFTAQDPSK	552	24
	51	3	HLSPELAQTISTLGLFTAQDPSK	n.d.	2
	61	4	STLGLFTAQDPSK	2	3
	63	5	LGLFTAQDPSK	4	2
	64	6	GLFTAQDPSK	6	6
	66	7	FTAQDPSK	4	5
Phe208	202	1	AELSGFSMASDVLELALVTPEK	37	727
	202	2	AELSGFSMASDVLELALVTPEK	253	3
Met220	202	1	AELSGFSMASDVLELALVTPEK	34	731
	202	2	AELSGFSMASDVLELALVTPEK	253	3

The strong interaction with PGS and Phe may be explained by the fact that many Phe residues in CviUPO are exposed on the outside of the protein. The aromatic ring of Phe seems to react with OH or other highly reactive oxygen species. Two of the modified phenylalanines, Phe51 and Phe67, are located near the substrate channel and their modification could influence the enzyme activity. The chemical reactions of free amino acids with plasma-derived RONS have been extensively studied and it has been shown that Phe is rapidly oxidized in the aromatic ring and hydroxylation or nitration could be detected after longer plasma treatment of 10 min ⁴³. Although experimental investigations have confirmed specific modifications, including the oxidation of aromatic amino acids such as Phe in DBD plasma-treated glycinin ⁴⁴, plasma-induced amino acid modifications in proteins have not been extensively studied to date. Hence, SASA-based interaction predictions are highly relevant, as the observed modifications at Phe were significant and in agreement with our experimental data.
Since the active site of an enzyme is responsible for substrate and co-substrate binding and thus also for enzymatic activity, the investigation after plasma treatment is of particular importance. The amino acids His90, Thr158, Phe88, Glu162, Tyr166 and Cys19 are primarily involved in the catalytic cycle. ⁴² The residues His90, Glu162 and Tyr166, are conserved and located distal to the catalytic center, while the proximal Cys19 is involved in the reaction. Residues Phe88 and Thr158 are also involved in substrate-heme interactions close to the heme access channel. Although interactions with amino acids in the active center of the CviUPO like Phe88 were not observed in the experimental study, this could occur with longer plasma treatment times.
While Phe can undergo hydroxylation reactions, sulfur-containing amino acid residues in proteins like Cys or Met exhibit greater susceptibility to oxidative modifications and rapidly react with ROS ⁴⁵. The thiol group of cysteine readily reacts with ROS, leading to the formation of disulfide bonds, sulfenic (-SOH), sulfinic (-SO2H), or sulfonic (-SO3H) acids, significantly altering protein structure and function ⁴⁵. Methionine, with its thioether group, is also a prime target for oxidation, resulting in the formation of methionine sulfoxide and, under prolonged oxidative stress, methionine sulfone ⁴³. Interaction profiles from SASA showed no interactions between PGS and Met or Cys, which we explain by the fact that these are buried in the protein structure and not on the solvent-accessible surface or are already engaged in covalent bonds (Cys19-Heme). However, mass spectrometry analysis showed modified Met42 and Met220 in all replicates, resulting in the majority of Met to be oxidized after 5 min treatment (Met+O) .
SASA interaction profiles predicted strong interactions between PGS such as OH, H2O2, O2 and the basic amino acids Lys and Arg, which are both known to be proton donor residues. However, amino acid modifications such as dehydrogenation of arginine, hydroxylation and/or dehyrogenation of lysine were detected only in some replicates and at low relative intensity. Due to the positive charge, these amino acids could be modified by reactive nitrogen species, which has not yet been investigated experimentally. For more detailed analyses, further possible modifications and plasma treatment times should be included. In addition, modifications to other amino acids should be investigated and the sequence coverage should be increased from 70% in the current analysis. If amino acids in the active center of the enzyme are modified, this could lead to enzyme inactivation. Depending on the residues affected, enzyme engineering could be a viable approach to selectively exchange amino acids, thereby improving protein plasma stability.

5 Conclusion

The SASA analysis method presented here allows to identify regions of interest on a protein surface with respect to interaction with a small reactive molecule. This method is not only applicable to protein–plasma interactions but also to other problems, such as the prediction of ligand binding sites on a protein. This approach could be used for a first and rather rough scan of the protein surface for attractive binding positions. As discussed in detail at the end of section 2.1 (”SASA interaction analyis – CviUPO”), a subsequent validation of any predicted positions is always recommended because a high interaction energy at a certain position does not necessarily mean that a species will bind there. Especially under real experimental condition the presence of the solvent plays an important role. Here, the simulation indicated that most reactive species rather react with water molecules than with the protein surface. Nevertheless, the simulations in the section ”Interactions of CviUPO with high rmdPGS concentrations”4.2 showed that even in random configuration with enough time some of the reactive species will bind to the enzymes on similar residues as predicted by the SASA analysis method. The results of this study highlight that any experimental setup that prolongs the diffusion path of reactive species in the solvent leads to a reduction in modifications to the enzymes. In the case studied here, prolonged diffusion through the liquid phase increases the probability that the PGS will react with the solvent rather than modifying the enzymes, which is consistent with the experimental results from Yayci et al.⁴⁶ . In their study the binding of the enzymes to beads placed at the bottom of a beaker prolonged the diffusion path of the PGS towards the enzyme and also promoted steric interference for the PGS to reach potentially attractive binding sites. Additionally, the experimental results from the mass spectrometry measurements, presented in this work, are in good agreement with the predictions from the SASA method. In particular, the predicted modification of phenylalanine was confirmed by the MS measurements, suggesting that ROS OH and O play an important role in the CviUPO inactivation. The Phe modification by plasma treatment has thus been brought into focus by the SASA analysis, which prompted the inclusion of Phe modifications in the MS database search. This suggests that perhaps some of the other predictions of the method can also be verified experimentally. Although the predicted modifications of Arg, Lys, Cys, and Met were also searched for, only Met modifications were observed. The combination of the results from both methods does not only help to gain deeper insights into the mechanism of plasma-induced modifications of the enzymes but also the SASA analysis method can help simplify target oriented evaluation of the MS data. In the future, further experimental studies should be carried out to test the general validity of the SASA model applying it to other systems.

C.J., J.E.B and T.J. gratefully acknowledge funding through the DFG (CRC 1316-2). The authors acknowledge support by the state of Baden-Württemberg through bwHPC and the DFG through grant no INST 40/575-1 FUGG (JUSTUS 2 cluster). J.E.B. is grateful to the State of North Rhine-Westphalia and the European Union - European Regional Development Fund ”Investing in your Future”, Research Infrastructure ”Center for Systems Antibiotics Research - CESAR” for funding of the mass spectrometer.

The authors declare no conflict of interest.

5.1 Amino acid sequence of CviUPO

Figure 1: Amino acid sequence of the Collariella virescens UPO used in the experimental study. The poly-His tail sequence is shown in italics and thrombin recognition sequence is underlined. The amino acid positions without the poly-His tail sequence (utilized in the text) are shown in brackets.

5.2 Explanation to the species nature in ReaxFF

It is important to note that, due to the limitations of the reactive molecular dynamics approach, modeling real plasma species remains a significant challenge. Fundamentally, the primary limitation arises from the nature of the datasets used to parameterize force fields (FFs). High-quality FFs are typically derived from quantum mechanical (QM) calculations, which are inherently restricted to ground-state descriptions. Consequently, any molecular dynamics (MD)-scale representation of plasma species is necessarily limited in accuracy. While the explicit treatment of plasma species within the QM regime is a distinct and important topic, it falls outside the scope of the present study. In a similar context, and most importantly, the ReaxFF employed in this study was not developed by us ³³. Therefore, we have no direct knowledge of whether specific species, such as OH radicals or OH ions, were included in the original training dataset. Even if such species were incorporated, the current ReaxFF framework does not explicitly treat electrons, making a rigorous distinction between radicals and ions fundamentally challenging. Efforts to address this issue, such as the development of eReaxFF, are ongoing, but they represent a separate and complex research direction. By design, ReaxFF relies on the bond-order formalism to simulate bond dissociation and formation, setting it apart from conventional FFs. In addition to bond order, ReaxFF employs dynamic charge equilibration, allowing for the tracking of charge redistribution. For OH species, this means that charge variations in the surrounding environment or counter ions may provide some insights into partial charge changes ^{32, 47, 48}. For instance, an analysis of the bond order and partial charge variations among OH species could suggest possible differences in their chemical nature. However, at a fundamental level, the reliability of ReaxFF is entirely dependent on the quality of the training dataset and the methodology used in its parametrization. In particular, charge-related properties are known to be less accurate within this framework. As a result, distinguishing between OH ions and OH radicals in our study remains highly uncertain.
In summary, the ReaxFF employed here lacks the precision required to unambiguously differentiate OH radicals from OH ions. Consequently, any conclusions drawn from these simulations should be interpreted with caution.
While the limitations of the force field should be considered, they only moderately affect the interpretation of the results. This is because, in a real system, it can be assumed that species from the plasma effluent diffuse through several milliliters of solvent before interacting with the enzyme, likely losing their excitation and possibly their radical characteristics by the time they reach the enzyme.

5.3 SASA interaction analysis

5.3.1 CviUPO

Figure 2: Interaction profiles from SASA for the enzyme CviUPO at 300 K with (a) H and (b) OH, (c) H2O2, (d) NO, (e) O2 and (f) O.

i H

ii OH

Figure 3: SASA interaction profile for H and OH with CviUPO at different temperatures: (a) at 300 K, (b) 400 K, and (c) at 500 K.

i H2O2

ii NO

Figure 4: SASA interaction profile for H2O2 and NO with CviUPO at different temperatures: (a) at 300 K, (b) 400 K, and (c) at 500 K.

i O2

ii O

Figure 5: SASA interaction profile for O2 and O with CviUPO at different temperatures: (a) at 300 K, (b) 400 K, and (c) at 500 K.

Table 1: Data for the short validation MD simulations from Section ”SASA interaction analysis CviUPO” 4.1.1 for all tested rmdPGS at 300 K in vacuum. Of the ten tested SASA positions (with the lowest interaction energies) only those SASA points are in the table listed where an immediate reaction occurred. Therefore, the rows of H2O2 and O2 do not contain any data. The full data set is available and has been provided alongside the main paper.

H	xyz	SASA closest residue	SASA E_int / eV	MD interaction
	0.025 2.826 -23.8	Glu124	-0.217	OE1 (Glu124)
	-15.765 -12.366 11.894	Asp104	-0.212	OD1 (Asp104)
	-0.381 19.075 1.27	Thr221	-0.207	O (221)
	-13.936 -12.142 12.812	Lys103	-0.202	OD1 (Asp104)
	0.803 1.108 -22.84	Tyr125	-0.201	OH (Tyr125)
	-0.298 20.662 10.614	Leu225	-0.191	O (Leu225)
	10.015 11.442 -7.978	Glu216	-0.186	O (Glu216)
	-11.175 0.619 5.562	Arg96	-0.183	O (Arg96)
OH	xyz	SASA closest residue	SASA E_int / eV	MD interaction
	1.107 21.172 3.397	Leu225	-0.825	HN (Leu225)
	-4.136 1.205 13.22	Asp91	-0.793	HN (Asp91)
	-2.516 -8.267 19.134	Arg84	-0.728	HE (Arg84)
	2.024 12.392 16.171	Val153	-0.728	HG23 (Val153)
H2O2	xyz	SASA closest residue	SASA E_int / eV	MD interaction
				no reaction
NO	xyz	SASA closest residue	SASA E_int / eV	MD interaction
	-6.19 -22.057 -9.084	Thr9	-1.01	HN (Thr9)
O	xyz	SASA closest residue	SASA E_int / eV	MD interaction
	1.107 21.172 3.397	Leu225	-1.175	HN (Leu225), HN (Ile18)
	-18.717 -3.891 -8.046	Lys114	-1.127	HN (Lys114)
	-6.255 20.747 6.826	Lys224	-1.125	HZ2 (Lys224)
	-6.493 20.708 6.454	Glu223	-1.12	HN (Lys224)
	3.565 -21.510 12.105	Asn37	-1.081	HN (Asn37)
	-14.064 -7.808 -13.948	Lys184	-1.071	HZ2 (Lys184)
O2	xyz	SASA closest residue	SASA E_int / eV	MD interaction
				no reaction

Table 2: Data for the short validation MD simulations from Section ”SASA interaction analysis CviUPO” 4.1.1 for all tested rmdPGS at 300 K in solvent. Of the ten tested SASA positions (with the lowest interaction energies) only those SASA points are in the table listed where an immediate reaction occurred. Therefore, the rows of H2O2 and O2 do not contain any data. The full data set is available and has been provided alongside the main paper.

H	xyz	SASA closest residue	SASA E_int / eV	MD interaction
	-0.296 20.962 11.561	Asp227	-0.19	OD2 (Asp227)
OH	xyz	SASA closest residue	SASA E_int / eV	MD interaction
				no reaction
H2O2	xyz	SASA closest residue	SASA E_int / eV	MD interaction
	-4.654 3.113 10.773	Gln155	-1.269	HE21 (Gln155)
	-4.425 0.721 13.495	Asp91	-1.146	H (Asp91)
	-3.29 -0.177 13.716	Hish85	-1.081	HE1 (Hish85)
NO	xyz	SASA closest residue	SASA E_int / eV	MD interaction
	-0.437 -20.604 -15.493	Lys8	-1.018	HG1, CG (Lys8)
	2.763 -21.539 12.001	Arg36	-1.001	HA (Arg36)
O	xyz	SASA closest residue	SASA E_int / eV	MD interaction
				no reaction
O2	xyz	SASA closest residue	SASA E_int / eV	MD interaction
	2.79 -21.421 11.992	Thr78	-1.368	HB (Thr78), HG1 (Arg36)
	2.763 -21.539 12.001	Arg36	-1.357	HB (Thr78), HG1 (Arg36)

The results for higher temperatures were excluded from this section to minimize the length of the Supplementary Information. However, the corresponding data are available and have been provided alongside the main paper.

5.3.2 AaeUPO

Figure 6: Interaction profiles from SASA for the enzyme AaeUPO at 300 K. (a) shows the interaction map with H and (b), (c), (d), (e) and (f) show the interaction maps for OH, H2O2, NO, O2 and O, respectively.

Figure 7: SASA total interactions per residue at 300 K for AaeUPO. (a) shows the interactions with H and (b), (c), (d), (e) and (f) show the interactions for OH, H2O2, NO, O2 and O, respectively.

Table 3: Data for the short validation MD simulations from Section ”Comparison to AaeUPO and GapA”4.1.2 for all tested rmdPGS at 300 K in vacuum. Of the ten tested SASA positions (with the lowest interaction energies) only those SASA points are in the table listed where an immediate reaction occurred. Therefore, the rows of H2O2, NO and O2 do not contain any data. The full data set is available and has been provided alongside the main paper.

H	xyz	SASA closest residue	SASA E_int / eV	MD interaction
	1.941 -7.982 -26.657	Glu146	-0.275	OE2 (Glu146)
	1.026 -7.549 -26.845	Glu142	-0.247	OE2 (Glu146)
	-2.554 -5.693 19.374	Asp91	-0.223	OD1 (Asp91)
	4.14 14.58 12.59	Gln313	-0.192	O (Phe321)
	-2.328 -8.81 18.342	Thr90	-0.189	O (Thr90)
	3.225 15.249 12.77	Val315	-0.183	O (Phe321)
	-11.902 21.905 -3.468	Ser271	-0.182	O (Ser271)
	14.725 -5.608 8.976	Asn61	-0.180	OD1 (Asn61)
OH	xyz	SASA closest residue	SASA E_int / eV	MD interaction
	-7.076 6.975 -8.468	Arg189	-0.842	HH21 (Arg189)
	15.438 6.689 6.478	Leu9	-0.832	HN (Leu9)
	12.739 12.509 -13.144	Leu162	-0.804	HN (Leu162)
	-21.881 4.895 -20.556	Ile262	-0.769	HN (Ile262)
H2O2	xyz	SASA closest residue	SASA E_int / eV	MD interaction
				no reactions
NO	xyz	SASA closest residue	SASA E_int / eV	MD interaction
				no reactions
O2	xyz	SASA closest residue	SASA E_int / eV	MD interaction
				no reactions
O	xyz	SASA closest residue	SASA E_int / eV	MD interaction
	-5.719 20.127 -7.11	Phe274	-1.159	HD1 Phe274
	-21.881 4.895 -20.556	Ile262	-1.137	HN Ile262
	20.19 2.179 9.391	Glu10	-1.118	HN (Glu10), HN (Asn11)
	-12.742 6.762 24.991	Asn328	-1.112	HD2 (Arg301), HD21 (Asn328)
	11.861 13.57 -1.451	Ser240	-1.09	HN (Ser240)
	-5.344 20.631 -6.851	Phe274	-1.057	HN (Phe274), HH21 (Arg257)

No interactions between the rmdPGS and AaeUPO were detected in the short SASA MDs with solvent.

The results for higher temperatures were excluded from this section to minimize the length of the Supplementary Information. However, the corresponding data are available and have been provided alongside the main paper.

5.3.3 GapA

Figure 8: Interaction profiles from SASA for the enzyme GapA at 300 K. (a) shows the interaction map with H and (b), (c), (d), (e) and (f) show the interaction maps for OH, H2O2, NO, O2 and O, respectively.

Figure 9: SASA total interactions per residue at 300 K for GapA. (a) shows the interactions with H and (b), (c), (d), (e) and (f) show the interactions for OH, H2O2, NO, O2 and O, respectively.

Table 4: Data for the short validation MD simulations from Section ”Comparison to AaeUPO and GapA”4.1.2 for all tested rmdPGS at 300 K in vacuum. Of the ten tested SASA positions (with the lowest interaction energies) only those SASA points are in the table listed where an immediate reaction occurred. Therefore, the rows of H2O2, NO and O2 do not contain any data. The full data set is available and has been provided alongside the main paper.

H	xyz	SASA closest residue	SASA E_int / eV	MD interaction
	-14.174 13.575 -22.124	Glu202	-0.234	OD1 (Asp187)
	16.83 2.245 21.372	Leu333	-0.213	OT1 (Leu333)
	16.632 2.676 21.313	Gly140	-0.211	OT1 (Leu333)
	-11.523 -7.879 2.094	Ser285	-0.207	O (Asp281)
	-3.328 -20.437 -13.4	Thr296	-0.197	O (Thr296)
	-14.856 -16.476 -5.369	Glu276	-0.195	O (Glu276)
	-12.534 -7.989 2.371	Asp281	-0.191	O (Asp281)
	-18.562 18.793 22.722	Asp59	-0.191	OD1 (Asp59)
	-12.437 -7.571 2.860	Ile83	-0.190	O (Ile283)
	20.023 -18.895 -15.649	Glu169	-0.188	OE1 (Glu169)
OH	xyz	SASA closest residue	SASA E_int / eV	MD interaction
	-2.05 -5.305 12.117	Arg19	-0.807	HH11 (Arg19)
	-12.752 -7.05 -10.723	Ser279	-0.799	HN (Ser279)
	-10.964 13.683 2.709	Arg14	-0.73	HH22 (Arg14)
	-12.16 -7.333 -10.803	Trp312	-0.711	HN (Ser279)
	8.812 22.837 8.457	Lys81	-0.704	HN (Lys81)
	-14.238 4.07 8.004	Arg18	-0.702	HH21 (Arg18)
H2O2	xyz	SASA closest residue	SASA E_int / eV	MD interaction
				no reactions
NO	xyz	SASA closest residue	SASA E_int / eV	MD interaction
				no reactions
O2	xyz	SASA closest residue	SASA E_int / eV	MD interaction
				no reactions
O	xyz	SASA closest residue	SASA E_int / eV	MD interaction
	-10.109 13.349 2.4	Arg14	-1.097	HH12 (Arg14)
	-12.752 -7.05 -10.723	Ser279	-1.085	HN (Ser279), HG1 Ser279)
	-5.333 24.677 -17.099	Arg190	-1.07	HD2 (Arg190)
	8.637 11.106 -16.115	Arg195	-1.058	HH11 (Arg195)
	8.812 22.837 8.457	Lys81	-1.047	HN (Lys81)
	-12.160 -7.333 -10.803	Trp312	-1.032	HN (Ser279)

No interactions between the rmdPGS and GapA were detected in the short SASA MDs with solvent.

The results for higher temperatures were excluded from this section to minimize the length of the Supplementary Information. However, the corresponding data are available and have been provided alongside the main paper.

5.4 Interactions with high PGS concentrations

5.4.1 CviUPO

i Without solvent

ii With solvent

Figure 10: Bond analysis for high concentrations of H with CviUPO. All panels show the total number of bonds to an additional hydrogen atom per residue and the relative interactions calculated following equation 3. The panels (a) and (d) show the interactions at 300 K, without and with solvent, respectively. The panels (b) and (e) show the interactions at at 400 K and the panels (c) and (f) show the interactions at at 500 K

i Without solvent

ii With solvent

Figure 11: Bond analysis for high concentrations of H2O2 with CviUPO. All panels show the total number of bonds to an additional hydrogen atom per residue and the relative interactions calculated following equation 3. The panels (a) and (d) show the interactions at 300 K, without and with solvent, respectively. The panels (b) and (e) show the interactions at at 400 K and the panels (c) and (f) show the interactions at at 500 K

i Without solvent

ii With solvent

Figure 12: Bond analysis for high concentrations of NO with CviUPO. All panels show the total number of bonds to an additional hydrogen atom per residue and the relative interactions calculated following equation 3. The panels (a) and (d) show the interactions at 300 K, without and with solvent, respectively. The panels (b) and (e) show the interactions at at 400 K and the panels (c) and (f) show the interactions at at 500 K

i Without solvent

ii With solvent

Figure 13: Bond analysis for high concentrations of O2 with CviUPO. All panels show the total number of bonds to an additional hydrogen atom per residue and the relative interactions calculated following equation 3. The panels (a) and (d) show the interactions at 300 K, without and with solvent, respectively. The panels (b) and (e) show the interactions at at 400 K and the panels (c) and (f) show the interactions at at 500 K

i Without solvent

ii With solvent

Figure 14: Bond analysis for high concentrations of oxygen with CviUPO. All panels show the total number of bonds to an additional hydrogen atom per residue and the relative interactions calculated following equation 3. The panels (a) and (d) show the interactions at 300 K, without and with solvent, respectively. The panels (b) and (e) show the interactions at at 400 K and the panels (c) and (f) show the interactions at at 500 K

5.4.2 AaeUPO

The interaction behavior of the PGS with AaeUPO shows more pronounced differences to the SASA predictions. While the SASA analysis showed various interactions between PGS and Arg, these are much reduced in the MD simulations. It is particularly striking that all PGS show a strong tendency towards proline (Pro) in the MD simulations, which might be due to the fact that Pro is the second most frequent amino acid in the protein. Similar to the other two enzymes temperature increase does not seem to change the behavior significantly. Interestingly the interaction profiles of the solvent simulations of AaeUPO are closer to the SASA predictions than the vacuum results. One explanation for this could be that the PGS in the solvent have the opportunity to diffuse to their preferred interaction partners. Nevertheless, the results should also be treated with caution here, as the error bars are still very high.

i Without solvent

ii With solvent

Figure 15: Bond analysis for high concentrations of PGS with AaeUPO at 300 K. All panels show the total number of bonds to an additional hydrogen atom per residue and the relative interactions calculated following equation 3. (a) shows the bonds to H without solvent while (b) and (c) show the bonds to OH, H2O2. The panel (d) shows the bonds to H with solvent. (b) and (c) show the bonds with solvent for OH, H2O2, respectively.

i Without solvent

ii With solvent

Figure 16: Bond analysis for high concentrations of PGS with AaeUPO at 300 K. All panels show the total number of bonds to an additional hydrogen atom per residue and the relative interactions calculated following equation 3. (a) shows the bonds to NO without solvent while (b) and (c) show the bonds to O2, O. The panel (d) shows the bonds to NO with solvent.( b) and (c) show the bonds with solvent for O2, O, respectively.

The results for higher temperatures were excluded from this section to minimize the length of the Supplementary Information. However, the corresponding data are available and have been provided alongside the main paper

5.4.3 GapA

For GapA, the MD simulations also follow the trend of the SASA predictions. For most PGS the results of the MD simulations look very similar with slight changes in the ratios. Overall, Lys is the most attacked amino acid for all tested PGS, followed by Thr and Arg. Interestingly, NO interacts with more residues in the MD simulations than predicted by the SASA analysis, although the variety of different residues is smaller compared to the other PGS. As with CviUPO, the solvent results are even closer to the SASA predictions.

i Without solvent

ii With solvent

Figure 17: Bond analysis for high concentrations of PGS with GapA at 300 K. All panels show the total number of bonds to an additional hydrogen atom per residue and the relative interactions calculated following equation 3. (a) shows the bonds to H without solvent while (b) and (c) show the bonds to OH, H2O2. The panel (d) shows the bonds to H with solvent. (b) and (c) show the bonds with solvent for OH, H2O2, respectively.

i Without solvent

ii With solvent

Figure 18: Bond analysis for high concentrations of PGS with GapA at 300 K. All panels show the total number of bonds to an additional hydrogen atom per residue and the relative interactions calculated following equation 3. (a) shows the bonds to NO without solvent while (b) and (c) show the bonds to O2, O. The panel (d) shows the bonds to NO with solvent. (b) and (c) show the bonds with solvent for O2, O, respectively.

The results for higher temperatures were excluded from this section to minimize the length of the Supplementary Information. However, the corresponding data are available and have been provided alongside the main paper