Protein Discovery with Discrete Walk-Jump Sampling
Abstract
We resolve difficulties in training and sampling from a discrete generative model by learning a smoothed energy function, sampling from the smoothed data manifold with Langevin Markov chain Monte Carlo (MCMC), and projecting back to the true data manifold with one-step denoising. Our Discrete Walk-Jump Sampling formalism combines the maximum likelihood training of an energy-based model and improved sample quality of a score-based model, while simplifying training and sampling by requiring only a single noise level. We evaluate the robustness of our approach on generative modeling of antibody proteins and introduce the distributional conformity score to benchmark protein generative models. By optimizing and sampling from our models for the proposed distributional conformity score, 97-100% of generated samples are successfully expressed and purified and 35% of functional designs show equal or improved binding affinity compared to known functional antibodies on the first attempt in a single round of laboratory experiments. We also report the first demonstration of long-run fast-mixing MCMC chains where diverse antibody protein classes are visited in a single MCMC chain.
1 Introduction
Discrete sequence generation poses a number of challenges to gradient-based generative models. Generative models must be expressive enough to faithfully capture the underlying data distribution, while also having controllable outputs that are novel, unique, diverse, and respect the constraints of the problem space. Energy-based models (EBMs) (Hinton & Sejnowski, 1986; LeCun et al., 2006) fit an energy function that specifies a probability distribution over data analogous to the Boltzmann distribution from statistical physics. Giving access to an easily computable energy is an advantage of EBMs, but on the flip-side they can be difficult to train and sample from. Denoising objectives based on score matching (Hyvärinen, 2005; Vincent, 2011) and the related advancements in diffusion models (Sohl-Dickstein et al., 2015; Ho et al., 2020) overcome these issues, but these either model the energy gradient or only provide access to an empirical lower-bound of the likelihood.
Protein design is an instance of the discrete sequence generation problem, wherein the challenge is to find useful proteins in the large, discrete, and sparsely functional space (Romero & Arnold, 2009) of dimension for proteins of length . Here, we consider the specific problem of generative modeling of antibodies, a class of proteins with highly conserved structure that are of immense interest for therapeutics. In addition to the qualities mentioned above, generative models for antibodies must be sample-efficient because of the relatively small size of datasets with therapeutic antibodies (Kim et al., 2023). Antibodies consist of well-conserved domains and high-entropy variable regions, so leveraging evolutionary information from pre-trained protein language models is not an immediate solution. We distinguish ab initio protein discovery and design (producing novel, functional proteins given some training samples), which is the focus of this work, from de novo design, which we define as the generation of novel proteins without starting material. Existing autoregressive protein design methods (Jin et al., 2021) are inefficient and can suffer from accumulation of errors and high inference latency, while current non-autoregressive diffusion models are similarly inefficient and poorly optimized for real discovery and design tasks (Kong et al., 2022). Our goal here is to invent an efficient, non-autoregressive generative modeling paradigm for discrete data that produces high quality, novel samples.
To this end, we introduce Smoothed Discrete Sampling (SDS), a new formalism for training and sampling from discrete generative models. We propose a novel algorithm, discrete Walk-Jump Sampling (dWJS), a method building on the neural empirical Bayes (NEB) (Saremi & Hyvärinen, 2019) formalism, that addresses the brittleness of discrete EBMs and diffusion models and in doing so, provides a robust and general framework for protein discovery and design.111https://github.com/Genentech/walk-jump We also design a metric called the Distributional Conformity Score (DCS), which is a simple scalar score for protein sample quality. Our results rescue EBMs for discrete distribution modeling and question the need for diffusion models with multiple noise scales in protein discovery.
Our contributions are as follows:
-
•
We introduce a new paradigm for modeling discrete data distributions, Smoothed Discrete Sampling (SDS), building on the neural empirical Bayes framework. We propose the discrete Walk-Jump sampling algorithm, which uses uncoupled, separately trained score- and energy-based models to learn noisy data distributions and sample discrete data. dWJS enables fast, non-autoregressive sampling with variable length discrete outputs. We also design a novel architecture for discrete EBMs.
-
•
Our method simplifies score-based model training for discrete data by requiring only a single noise level and no noise schedule, which alleviates the brittleness, training instabilities, and slow sampling of diffusion models. Our method also resolves difficulties in training EBMs, obviating the need for many common EBM training tricks (replay buffer, norm penalty, rejection sampling, etc.), while preserving good sample quality and fast sampling.
-
•
We demonstrate the utility of our approach in the context of ab initio protein discovery and design - generating novel, biophysically-valid protein sequences from models trained on repertoires of functional molecules. We validate our method with in vitro experiments. Our method outperforms autoregressive large language models, diffusion, and score-based baselines.
2 Background
2.1 Energy-based models
EBMs are a class of models that learn an energy function mapping inputs (in ) to a scalar “energy" value. The data distribution is approximated by the Boltzmann distribution
EBMs are typically trained via contrastive divergence (Hinton, 2002), and new samples are drawn from by Markov-Chain Monte Carlo (MCMC). Details of the loss function used in this work are given in Section 3. In Langevin MCMC, samples are initialized from a known data point or random noise and refined with (discretized) Langevin diffusion
| (1) |
where denotes the gradient of the energy function with respect to inputs, is the sampling step, is the (discretization) step size, and the noise is drawn from the normal distribution at each step.
2.2 Neural empirical Bayes
In NEB, the random variable is transformed with additive Gaussian noise The least-squares estimator of given is given by (Robbins, 1956; Miyasawa, 1961)
| (2) |
where is the probability distribution function of the smoothed density.222 We follow the convention , etc. This estimator is often expressed directly in terms of known as the score function (Hyvärinen, 2005) which is parameterized with a neural network denoted by The least-squares estimator then takes the following parametric form:
| (3) |
Putting this all together leads to the following learning objective
| (4) |
which is optimized with stochastic gradient descent. Notably, no MCMC sampling is required during learning. In short, the objective is “learning to denoise” with an empirical Bayes formulation.
3 Antibody discovery and design
3.1 Discrete walk-jump sampling
Following training of the denoising network, , one can sample noisy data using the learned score function with Langevin MCMC (replace with in Eq. 1). For any such draws , clean samples from the true data manifold are obtained by “jumping” back to with the least-squares estimator This is the walk-jump sampling (WJS) scheme. A key property of WJS is the fact that the least-squares estimation (jump) is decoupled from the Langevin MCMC (walk).
Here, we take advantage of this decoupling to train an EBM with maximum likelihood estimation on the smoothed distribution of noisy sequences, generate noisy samples with Langevin MCMC, and denoise samples with a separately trained neural network, the least-squares estimator. The algorithm for discrete walk-jump sampling is given in Algo. 1. Our algorithm is general and applies to any discrete sequence inputs of a fixed vocabulary. In Fig. 1 we show samples generated from a single chain of MCMC. Unlike a diffusion model, every sample along the chain collectively forms a valid set of samples from the underlying distribution, because of the decoupled walk (sampling) and jump (denoising) steps. dWJS also produces fast-mixing chains, such that many diverse modes (protein classes) are sampled in a single chain. Samples are folded with EquiFold (Lee et al., 2022) for visualization and confirmation of structural validity.
The EBM is trained by maximizing the log-likelihood of noisy data under the model:
| (5) |
where are noisy training data and are noisy data sampled from the model.
With this objective, the model aims to decrease the energy of noisy training data (“positive” samples ) while increasing the energy of noisy data sampled from the model (“negative” samples ) in expectation. The following identity is behind the positive/negative phases in the EBM training:
| (6) |
where is the partition function.
Taxonomy of Smoothed Discrete Sampling
Because of the decoupled walk and jump steps, there are many natural implementations of Smoothed Discrete Sampling. Empirically, we find that Algo. 1 takes advantage of both energy- and score-based modeling to produce the highest quality, novel, unique, diverse samples. Four natural choices for performing sampling, which arise from different combinations of energy- and score-based parameterizations, are summarized in Table 1. Discrete Walk-Jump Sampling refers to walking with the EBM, , and jumping with the denoising network, . Score-based dWJS uses for both walking and jump steps. The Deep Energy Estimator Network (DEEN) (Saremi et al., 2018) approach uses a denoiser that is trained by taking the derivative of an energy and using the same learning objective as Eq. 4. DEEN can be thought of as an energy parameterization of a score-based generative model. Finally, dWJS-EBM uses an EBM for sampling and the gradient of the energy, , for denoising. Empirically, we find that the most performative method in terms of efficiency, sample quality, and diversity is the EBM walk and denoiser jump, which we refer to as Discrete Walk-Jump Sampling.
| Model | Walk (sampling) | Jump (denoising) |
|---|---|---|
| dWJS (energy-based) | EBM | Denoiser |
| dWJS (score-based) | Denoiser | Denoiser |
| Deep Energy Estimator Network | Denoiser (energy) | Denoiser (energy) |
| dWJS-EBM | EBM | EBM |
Variable length protein sequence generation.
We represent antibody protein molecules as , where corresponds to the amino acid (AA) type at position . Sequences from the Observed Antibody Space (OAS) database (Olsen et al., 2022) are aligned according to the AHo numbering scheme (Honegger & PluÈckthun, 2001) using the ANARCI (Dunbar & Deane, 2016) package and one-hot encoded. Aligning sequences in this way is a practical solution to handling insertions and deletions, which are otherwise troublesome for models that require fixed length inputs and outputs; alignment introduces a “gap" token that can be introduced or removed during sampling to effectively change the length of sequences. This allows the model to capture the distribution of lengths present in natural antibodies. The alignment step maps heavy and light chain sequences of varying lengths to a standard, gapped input size of 149 and 148 respectively with 21 possible discrete tokens including the gap. Thus, the input dimension for every sequence becomes . An EBM is trained via contrastive divergence on the manifold of smoothed, noisy one-hot encodings, , given by , , where . A separate denoising model is trained with the objective in Eq. 4. New antibody sequences are generated (Fig. 2) by sampling noisy samples with Langevin MCMC following gradients from the EBM, denoising with the least-squares estimator, and taking to recover a one-hot encoding. Further details related to training and network architecture are given in Appendix A.
Protein design vs discovery.
Protein discovery is the task of generating novel, unique, and valid samples. Protein design refers to taking some starting sequence and making edits to improve function. With dWJS we achieve discovery through unconditional sampling, while design is performed via constrained sampling and scoring. That is, we impose the following constraint in the form of a binary projection matrix
for , where is the number of conserved tokens in the sequence, is the noisy sequence at time step of Langevin MCMC, is the denoised sample at time , and is the starting sequence. This constraint ensures that the specified regions of the sequence are conserved, while the non-conserved regions are free to change during Langevin MCMC.
3.2 Derivation of optimal noise level for discrete sequence data
Throughout the experiments in Section 4, we must choose what noise level, , to use for training. Empirically, we find that in the protein discovery setting, is sufficient for getting good sample quality. Here, we provide some intuition for choosing a good , based on a geometric picture of the concentration of the measure (Saremi & Hyvärinen, 2019). We define the matrix with entries
| (7) |
where is the dimension of the data and the scaling comes from the concentration of isotropic Gaussians in high dimensions. The critical noise level, , is defined as
such that for , all noisy data have some degree of overlap. For our antibody sequence data, the statistics of the matrix are given in Table 2 and the histogram of values is shown in Appendix A.4. We find that , which agrees with our empirical hyperparameter optimization. Estimating in this way serves to motivate the empirical success of the used in our experiments, and provides helpful guidance on the scale of to use for discrete data. Here we take to be the length of the input vector ( for aligned antibody sequences); for the flattened sparse one-hot matrices with vocabulary size 21, . This scales by 0.22, which still gives a useful scale for , but is not optimal because of the sparsity of the one-hot matrices.
| min | median | mean | max | |
|---|---|---|---|---|
| 0.17 | 0.42 | 0.41 | 0.51 |
3.3 Distributional conformity score
The FID score in computer vision and metrics like the BLEU score in machine translation greatly simplify the evaluation of proposed methods; protein generation lacks such metrics, which motivates us to introduce the “distributional conformity score” (Fig. 3). The goal of the distributional conformity score is to provide a succinct description of how likely generated samples are with respect to a reference distribution, while maintaining novelty and diversity. Distributional conformity score is designed such that improving sample quality corresponds directly to increased probability of generating real, biophysically valid proteins.
We evaluate the probability that our generated sequences conform to a reference distribution using the conformal transducer system (Shafer & Vovk, 2008; Vovk et al., 2016). Let , , and .333In the discussion of distributional conformity score, refers to sample features; elsewhere in the paper refers to clean data. Here, refers to labels; elsewhere in the paper refers to noisy data. A conformity measure A is a measurable function that maps a sequence to a set of real numbers and is equivariant under permutations. Given a new example , we use A to measure how similar is to . The conformal transducer is then defined as a system of p-values where for each label , a reference sequence , and a test example , we have: where . Intuitively, is the fraction of examples that have a higher degree of conformity to the reference distribution than . Here, we define to be the likelihood under the join density over various properties, including biophysical properties and statistical properties, such as a log-probability under a protein language model. We use kernel density estimation to compute the joint density. To avoid overfitting the estimator, we split the reference set into a fitting set and a validation set, with the latter used to compute the p-values (Algo. 2). In our context, the reference distribution comprises all antibodies and the label represents the property of interest such as expression or binding.
4 Experiments
We evaluate our method, discrete Walk-jump sampling (dWJS) (Fig. 2), on three antibody generation tasks: 1) distribution learning on paired observed antibody space (Olsen et al., 2022); 2) the in vitro expression and purification of novel antibodies; and 3) most importantly, functional therapeutic antibody design (Mason et al., 2021). Crucially, we compare methods using our distributional conformity score, which is a sample-to-distribution metric to assess sample quality (analogous to an FID score), rather than the sequence recovery metrics used in previous antibody design work (Kong et al., 2022; Jin et al., 2021). Sequence recovery is a poor objective for our goal, which is the discovery of novel (large edit distance from known examples), functional antibodies. We also present surprising empirical results related to EBM parameter optimization with maximum likelihood training on noisy data that suggest a more general and robust training procedure for EBMs. Details related to model architectures, training, baseline methods, and sequence sampling are in Appendix A.
| Model | Unique | ||||
|---|---|---|---|---|---|
| dWJS (energy-based) | 0.056 | 1.0 | 58.4 | 55.3 | 0.38 |
| dWJS (score-based) | 0.065 | 0.97 | 62.7 | 65.1 | 0.49 |
| SeqVDM | 0.062 | 1.0 | 60.0 | 57.4 | 0.40 |
| DEEN | 0.087 | 0.99 | 50.9 | 42.7 | 0.41 |
| GPT 3.5 | 0.14 | 0.66 | 55.4 | 46.1 | 0.23 |
4.1 dWJS generates natural, novel, diverse antibodies in silico
We measure generative model performance with a suite of “antibody likeness" (ab-likeness) metrics including labels derived from the AA sequence with Biopython (Cock et al., 2009). Sequence property metrics are condensed into a single scalar metric by computing the distributional conformity score and the normalized average Wasserstein distance between the property distributions of samples and a validation set. The average total edit distance summarizes the novelty and diversity of samples compared to the validation set, while internal diversity () represents the average total edit distance between samples. Our method achieves strong ablikeness results (Table 3), simply by increasing to . dWJS with dEBM sampling achieves the best agreement with the validation set property distribution and highest percentage of unique samples, while dWJS with score-based sampling has the best distributional conformity score, novelty, and diversity. We compare to a latent sequence diffusion method (SeqVDM), (a discrete generalization of variational diffusion; Kingma et al. 2021), a score-based model with an energy parameterization (DEEN), and a pre-trained large language model (LLM) (GPT 3.5). Our dWJS methods have faster sampling time and lower memory footprint than diffusion and score-based baselines (Table 6), while also having high sample quality. Details on the baseline methods and GPT 3.5 prompts are given in Appendices A and D.
| Model | |
|---|---|
| dWJS (score-based) | 1.0 |
| dWJS (energy-based) | 0.97 |
| EBM | 0.42 |
4.2 dWJS generates natural, novel, diverse antibodies in vitro
Out of more than 277 designed antibody sequences tested in the laboratory, 270 were successfully expressed and purified (Table 4). We achieved the 97.47% in vitro success rate by developing dWJS to capture the antibody distribution in silico as measured by distributional conformity score. For comparison, sequences from an EBM (trained on clean data with samples drawn using traditional Langevin MCMC) achieved a 42% expression rate. An antibody sequence comprised of random vocabulary tokens would be expected to have a 0% expression rate, and in laboratory experiments we have confirmed that a small number of edits (< 4) can destroy expression if the proposal distribution (generative model) is poorly optimized.
| Model | |||
|---|---|---|---|
| dWJS (energy-based) | 0.96 | 0.34 | 0.35 |
| dWJS (score-based) | 0.95 | N/A | N/A |
| SeqVDM | 0.75 | 0.19 | 0.0 |
| GPT 4 | 0.74 | N/A | N/A |
| Transformer | 0.60 | N/A | N/A |
| EGNN | 0.58 | N/A | N/A |
4.3 dWJS generates functional antibody variants in vitro
To further show the robustness of our method, we consider the task of training generative models on a hu4D5 antibody mutant dataset (Mason et al., 2021) and compare to baseline models. The dataset consists of 9k binding and 25k non-binding hu4D5 CDR H3 mutants with up to 10 mutations (after de-duplication and removing samples that are labeled both binding and non-binding). This yields a dimensional search space. The mutants were measured in lab experiments to determine their binding to HER2 antigen. The goal of this benchmark task is to produce samples that are also predicted to bind to HER2. We trained dWJS models (score-based and energy-based) on only the binder set at a noise level of , while also training a 1D-CNN binary classifier to classify binders and non-binders. The classifier achieves 86% accuracy on an IID validation split. Then, we classified 1000 samples from each dWJS generative model and four baseline models trained on the hu4D5 mutant dataset. We compare to three diffusion models: 1) a sequence transformer based on BERT (Devlin et al., 2018) that generates sequences, 2) an E(n) Equivariant Graph Neural Network (EGNN) (Satorras et al., 2021) that codesigns , and 3) a latent sequence diffusion model, SeqVDM; and a pre-trained LLM, GPT 4. The specific prompt used for GPT 4 is given in Appendix D. The probability of binding for unique designs from each model is reported in Table 5. dWJS models produce the highest percentage of unique predicted binders.
We also report in vitro wetlab validation results for active drug discovery projects.444 Due to the sensitive nature of data, we do not disclose specific drug targets for these experiments. dWJS produces the highest percentage of functional antibodies that bind to target ( in Table 5), and the highest percentage of antibodies that bind with equal or better affinity compared to previously known binders ( in Table 5). Further details on wetlab experiments are presented in Appendix E
5 Related Work
Energy-based models (EBMs) (LeCun et al., 2006) are a class of physics-inspired models that learn an energy function defining a probability distribution over data with a rich history that goes back to Boltzmann machines (Hinton & Sejnowski, 1986). Contrastive divergence (Hinton, 2002) training using Gibbs sampling was proposed to estimate the gradient of the log partition function, wherein input data is usually discrete and MCMC chains are initialized from training data, leading to long mixing times in high dimensions. Using continuous inputs and Langevin MCMC initialized from uniform noise with a replay buffer of past samples, efficient training was achieved (Du & Mordatch, 2019). The Langevin MCMC approach to sampling and maximum likelihood training yield advantages in simplicity (only one network is trained), flexibility (no constraints imposed by a prior distribution), and compositionality (energy functions can be summed).
Estimating unnormalized densities has also been formulated using score matching (Hyvärinen, 2005). This formulation led to probabilistic models for denoising autoencoders (Vincent, 2011; Alain & Bengio, 2014; Saremi et al., 2018), but also has an empirical Bayes interpretation that is most related to this work. In particular, the neural empirical Bayes (NEB) (Saremi & Hyvärinen, 2019) formalism unifies kernel density estimation (Parzen, 1962) and empirical Bayes (Robbins, 1956) to transform the unsupervised learning problem into a more tractable form where a neural network energy function is parameterized to capture a smoothed data distribution. Our work is the first study of the NEB formalism for discrete data. Whereas our approach relies on smoothing discrete data and learning energies and scores over the smooth distribution, (Meng et al., 2023) formulates discrete score matching by constructing a faithful approximation of continuous score matching via an inductive prior on the local topology of the data space. Additionally, discrete diffusion models such as (Austin et al., 2023) learn an iterative denoising process over many different noise levels by prescribing a noise process over discrete data that converges to a known categorical distribution.
Although generative modeling is widely adopted in image and natural language generation, successful applications of generative modeling in the sciences are few and far between, due to the over-representation of image and text datasets, challenges in evaluation, and the need for generating samples that are novel and diverse while respecting the underlying symmetries and structure of a particular domain. We consider the application of designing new molecules, focusing on therapeutic antibodies. Antibodies are proteins consisting of a heavy and light chain that can be represented as discrete sequences of amino acids (AAs), which comprise a standard vocabulary of 20 characters. Approaches borrowing from traditional ML generative modeling have been used to model antibodies (Shuai et al., 2021; Gligorijević et al., 2021; Ferruz & Höcker, 2022; Tagasovska et al., 2022), but typical natural-language-based methods struggle to capture the data distribution of antibodies, for which there is limited training data (1K - 1M high-quality sequences depending on the distribution of interest) and additional challenges due to the high-entropy variable regions of the sequence. Here, we address the above challenges with training and sampling discrete sequences using a novel formulation of decoupled energy- and score-based modeling.
6 Conclusions
We proposed Smoothed Discrete Sampling (SDS), a new paradigm for modeling discrete distributions that uses Langevin Markov-Chain Monte Carlo to sample from smoothed data distributions. We introduce the discrete Walk-Jump Sampling (dWJS) algorithm and evaluate it on the antibody discovery and design problems, showing the capability of our method to generate novel, diverse, and functional antibodies as measured by synthetic biophysical property distributions, similarity metrics, and in vitro experiments. The strong regularization provided by fitting the energy function to noisy data completely prevents overfitting and training instabilities, resulting in fast and efficient retraining and sampling with low compute requirements. dWJS discards many of the commonly used techniques for improving EBM training with Langevin MCMC (replay buffers, norm penalty, simulated annealing, rejection sampling, etc.) and reduces the engineering complexity of training EBMs and diffusion-based models to a single hyperparameter choice: the noise level, . Altogether, our results suggest a simplified, more general and robust framework for training and sampling from discrete energy- and score-based models with applications to therapeutic molecule design. Future work will probe the generality of our results to other classes of molecules and even other data modalities (e.g., images), as well as theoretical investigation into the results presented here.
Acknowledgments and Disclosure of Funding
The authors acknowledge the entire Prescient Design team and the Antibody Engineering department at Genentech for providing helpful discussions and input that contributed to the research results reported within this paper. The authors would like to especially acknowledge Simon Kelow, Franziska Seeger, and Andrew Watkins for helpful discussions related to antibody discovery, and Allen Goodman for consulting on large language model benchmarks.
References
- Alain & Bengio (2014) Guillaume Alain and Yoshua Bengio. What regularized auto-encoders learn from the data-generating distribution. Journal of Machine Learning Research, 15(1):3563–3593, 2014.
- Austin et al. (2023) Jacob Austin, Daniel D. Johnson, Jonathan Ho, Daniel Tarlow, and Rianne van den Berg. Structured denoising diffusion models in discrete state-spaces, 2023.
- Cock et al. (2009) Peter JA Cock, Tiago Antao, Jeffrey T Chang, Brad A Chapman, Cymon J Cox, Andrew Dalke, Iddo Friedberg, Thomas Hamelryck, Frank Kauff, Bartek Wilczynski, et al. Biopython: freely available python tools for computational molecular biology and bioinformatics. Bioinformatics, 25(11):1422–1423, 2009.
- Devlin et al. (2018) Jacob Devlin, Ming-Wei Chang, Kenton Lee, and Kristina Toutanova. Bert: Pre-training of deep bidirectional transformers for language understanding. arXiv preprint arXiv:1810.04805, 2018.
- Du & Mordatch (2019) Yilun Du and Igor Mordatch. Implicit generation and modeling with energy based models. Advances in Neural Information Processing Systems, 32, 2019.
- Dunbar & Deane (2016) James Dunbar and Charlotte M Deane. ANARCI: antigen receptor numbering and receptor classification. Bioinformatics, 32(2):298–300, 2016.
- Ferruz & Höcker (2022) Noelia Ferruz and Birte Höcker. Controllable protein design with language models. Nature Machine Intelligence, 4(6):521–532, 2022.
- Gligorijević et al. (2021) Vladimir Gligorijević, Daniel Berenberg, Stephen Ra, Andrew Watkins, Simon Kelow, Kyunghyun Cho, and Richard Bonneau. Function-guided protein design by deep manifold sampling. bioRxiv, 2021.
- Hinton (2002) Geoffrey E Hinton. Training products of experts by minimizing contrastive divergence. Neural computation, 14(8):1771–1800, 2002.
- Hinton & Sejnowski (1986) Geoffrey E Hinton and Terrence J Sejnowski. Learning and relearning in Boltzmann machines. Parallel distributed processing: Explorations in the microstructure of cognition, 1(282-317):2, 1986.
- Ho et al. (2020) Jonathan Ho, Ajay Jain, and Pieter Abbeel. Denoising diffusion probabilistic models. Advances in Neural Information Processing Systems, 33:6840–6851, 2020.
- Honegger & PluÈckthun (2001) Annemarie Honegger and Andreas PluÈckthun. Yet another numbering scheme for immunoglobulin variable domains: an automatic modeling and analysis tool. Journal of molecular biology, 309(3):657–670, 2001.
- Hsiao et al. (2020) Yi-Chun Hsiao, Ying-Jiun J Chen, Leonard D Goldstein, Jia Wu, Zhonghua Lin, Kellen Schneider, Subhra Chaudhuri, Aju Antony, Kanika Bajaj Pahuja, Zora Modrusan, et al. Restricted epitope specificity determined by variable region germline segment pairing in rodent antibody repertoires. In MAbs, volume 12, pp. 1722541. Taylor & Francis, 2020.
- Hyvärinen (2005) Aapo Hyvärinen. Estimation of non-normalized statistical models by score matching. Journal of Machine Learning Research, 6(Apr):695–709, 2005.
- Jin et al. (2021) Wengong Jin, Jeremy Wohlwend, Regina Barzilay, and Tommi Jaakkola. Iterative refinement graph neural network for antibody sequence-structure co-design. arXiv preprint arXiv:2110.04624, 2021.
- Kalchbrenner et al. (2016) Nal Kalchbrenner, Lasse Espeholt, Karen Simonyan, Aaron van den Oord, Alex Graves, and Koray Kavukcuoglu. Neural machine translation in linear time. arXiv preprint arXiv:1610.10099, 2016.
- Kim et al. (2023) Jisun Kim, Matthew McFee, Qiao Fang, Osama Abdin, and Philip M Kim. Computational and artificial intelligence-based methods for antibody development. Trends in Pharmacological Sciences, 2023.
- Kingma et al. (2021) Diederik P Kingma, Tim Salimans, Ben Poole, and Jonathan Ho. Variational diffusion models. In A. Beygelzimer, Y. Dauphin, P. Liang, and J. Wortman Vaughan (eds.), Advances in Neural Information Processing Systems, 2021.
- Kong et al. (2022) Xiangzhe Kong, Wenbing Huang, and Yang Liu. Conditional antibody design as 3d equivariant graph translation. arXiv preprint arXiv:2208.06073, 2022.
- LeCun et al. (2006) Yann LeCun, Sumit Chopra, Raia Hadsell, M Ranzato, and Fujie Huang. A tutorial on energy-based learning. Predicting structured data, 1(0), 2006.
- Lee et al. (2022) Jae Hyeon Lee, Payman Yadollahpour, Andrew Watkins, Nathan C Frey, Andrew Leaver-Fay, Stephen Ra, Kyunghyun Cho, Vladimir Gligorijevic, Aviv Regev, and Richard Bonneau. Equifold: protein structure prediction with a novel coarse-grained structure representation. bioRxiv, pp. 2022–10, 2022.
- Loshchilov & Hutter (2017) Ilya Loshchilov and Frank Hutter. Decoupled weight decay regularization. arXiv preprint arXiv:1711.05101, 2017.
- Mason et al. (2021) Derek M Mason, Simon Friedensohn, Cédric R Weber, Christian Jordi, Bastian Wagner, Simon M Meng, Roy A Ehling, Lucia Bonati, Jan Dahinden, Pablo Gainza, et al. Optimization of therapeutic antibodies by predicting antigen specificity from antibody sequence via deep learning. Nature Biomedical Engineering, 5(6):600–612, 2021.
- Meng et al. (2023) Chenlin Meng, Kristy Choi, Jiaming Song, and Stefano Ermon. Concrete score matching: Generalized score matching for discrete data, 2023.
- Miyasawa (1961) Koichi Miyasawa. An empirical Bayes estimator of the mean of a normal population. Bulletin of the International Statistical Institute, 38(4):181–188, 1961.
- Olsen et al. (2022) Tobias H Olsen, Fergus Boyles, and Charlotte M Deane. Observed antibody space: A diverse database of cleaned, annotated, and translated unpaired and paired antibody sequences. Protein Science, 31(1):141–146, 2022.
- Parzen (1962) Emanuel Parzen. On estimation of a probability density function and mode. The annals of mathematical statistics, 33(3):1065–1076, 1962.
- Paszke et al. (2019) Adam Paszke, Sam Gross, Francisco Massa, Adam Lerer, James Bradbury, Gregory Chanan, Trevor Killeen, Zeming Lin, Natalia Gimelshein, Luca Antiga, Alban Desmaison, Andreas Kopf, Edward Yang, Zachary DeVito, Martin Raison, Alykhan Tejani, Sasank Chilamkurthy, Benoit Steiner, Lu Fang, Junjie Bai, and Soumith Chintala. Pytorch: An imperative style, high-performance deep learning library. In Advances in Neural Information Processing Systems 32, pp. 8024–8035. Curran Associates, Inc., 2019.
- Robbins (1956) Herbert Robbins. An empirical Bayes approach to statistics. In Proc. Third Berkeley Symp., volume 1, pp. 157–163, 1956.
- Romero & Arnold (2009) Philip A Romero and Frances H Arnold. Exploring protein fitness landscapes by directed evolution. Nature reviews Molecular cell biology, 10(12):866–876, 2009.
- Sachs et al. (2017) Matthias Sachs, Benedict Leimkuhler, and Vincent Danos. Langevin dynamics with variable coefficients and nonconservative forces: from stationary states to numerical methods. Entropy, 19(12):647, 2017.
- Saremi & Hyvärinen (2019) Saeed Saremi and Aapo Hyvärinen. Neural empirical Bayes. Journal of Machine Learning Research, 20:1–23, 2019.
- Saremi et al. (2018) Saeed Saremi, Arash Mehrjou, Bernhard Schölkopf, and Aapo Hyvärinen. Deep energy estimator networks. arXiv preprint arXiv:1805.08306, 2018.
- Satorras et al. (2021) Vıctor Garcia Satorras, Emiel Hoogeboom, and Max Welling. E(n) equivariant graph neural networks. In International conference on machine learning, pp. 9323–9332. PMLR, 2021.
- Shafer & Vovk (2008) Glenn Shafer and Vladimir Vovk. A tutorial on conformal prediction. Journal of Machine Learning Research, 9(12):371–421, 2008. URL http://jmlr.org/papers/v9/shafer08a.html.
- Shuai et al. (2021) Richard W Shuai, Jeffrey A Ruffolo, and Jeffrey J Gray. Generative language modeling for antibody design. bioRxiv, 2021.
- Sohl-Dickstein et al. (2015) Jascha Sohl-Dickstein, Eric Weiss, Niru Maheswaranathan, and Surya Ganguli. Deep unsupervised learning using nonequilibrium thermodynamics. In International Conference on Machine Learning, pp. 2256–2265. PMLR, 2015.
- Tagasovska et al. (2022) Nataša Tagasovska, Nathan C Frey, Andreas Loukas, Isidro Hötzel, Julien Lafrance-Vanasse, Ryan Lewis Kelly, Yan Wu, Arvind Rajpal, Richard Bonneau, Kyunghyun Cho, et al. A pareto-optimal compositional energy-based model for sampling and optimization of protein sequences. arXiv preprint arXiv:2210.10838, 2022.
- Vincent (2011) Pascal Vincent. A connection between score matching and denoising autoencoders. Neural computation, 23(7):1661–1674, 2011.
- Vovk et al. (2016) Vladimir Vovk, Valentina Fedorova, Ilia Nouretdinov, and Alexander Gammerman. Criteria of efficiency for conformal prediction. CoRR, abs/1603.04416, 2016. URL http://arxiv.org/abs/1603.04416.
- Yang et al. (2022) Kevin K. Yang, Alex X. Lu, and Nicolo Fusi. Convolutions are competitive with transformers for protein sequence pretraining. bioRxiv, 2022. doi: 10.1101/2022.05.19.492714. URL https://www.biorxiv.org/content/early/2022/05/25/2022.05.19.492714.
Appendix
\parttocAppendix A Network architectures and training details
A.1 Discrete Walk-Jump Samplers
For all experiments we use an identical architecture for the EBM consisting of three Conv1D layers with kernel sizes 15, 5, and 3 and padding 1, ReLU non-linearities and an output linear layer of size 128. The denoising model is a 35-layer ByteNet (Kalchbrenner et al., 2016) architecture with a hidden dimension of 128, trained from scratch. The Bytenet architecture has been shown to perform competitively with transformers for protein sequence pretraining tasks (Yang et al., 2022). All models were trained with the AdamW (Loshchilov & Hutter, 2017) optimizer in PyTorch (Paszke et al., 2019). We used a batch size of 256, an initial learning rate of , and trained with early stopping.
A.2 dWJS stabilizes and simplifies training
We observe that the dWJS algorithm prevents instabilities during maximum likelihood training. EBMs commonly exhibit issues with training stability and divergences in the energy, due to the energy landscape becoming too complicated to sample. Noising the data provides strong regularization that prevents overfitting and instabilities. This is seen over a range of noise levels for EBMs trained over 3,000 steps. Training instabilities recur for . We investigate the effects of discarding many of the techniques for improved EBM training that, while introduced to ameliorate challenges with EBMs, also introduce complexities that make EBMs brittle, inflexible, and difficult to optimize. In particular, we discard the replay buffer, the norm penalty loss term to regularize the energies, Metropolis rejection sampling, and time step annealing. We use the Langevin MCMC algorithm (Algo. 4) from (Sachs et al., 2017) and eliminate the need for careful hyperparameter finetuning; is the only free hyperparameter in dWJS.
A.3 Diffusion baselines
In our comparison study we use the Sequence-based Variational Diffusion Model (SeqVDM) proposed by Kingma et al. Kingma et al. (2021), adapted for protein sequence data. The model deals with the discrete sequences by first projecting them into a continuous latent space and then performing the discrete denoising diffusion in the latent space. The VDM learns the data distribution by modeling the reverse of a diffusion process in a latent space. In all our experiments we used steps with the fixed noise schedule and . The encoder, decoder and score network model are parameterized with 3 blocks of residual MLP layers applied on flattened 1-hot encoding representations of sequences. The MLP layers project the initial sequence representation down to a dimensional latent space. The model is simultaneously trained to optimize the diffusion loss (i.e., the score-matching loss) and the sequence reconstruction loss. SeqVDM is trained on paired OAS with the AdamW optimizer and the initial learning rate of for 50 epochs. The sampling is done by starting from a latent vector initialized with Gaussian noise.
A.4 Estimation of hyperparameter
Appendix B Additional algorithms
B.1 Gradient flow enables local minima finding
We define the gradient flow as , where sampling is performed by following the flow of the gradient of the probability density function in a deterministic dynamics, rather than stochastic Langevin dynamics. We initialize sampling from noise at , , and sample noisy samples following the gradient flow. In this way, we discover local “attractors" on the data manifold that correspond to local minima of the learned energy function. The algorithm for discrete gradient flow is given in Algo. 3.
B.2 Langevin MCMC Update
Appendix C Performance profiling
| Model | Parameters (M) | GPU time / sample (ms) | GPU memory (MB) |
|---|---|---|---|
| dWJS (energy-based) | 9.87 | 64.89 | 4734.76 |
| dWJS (score-based) | 1.03 | 327.60 | 16.7 |
| SeqVDM | 12.31 | 940.40 | 246.39 |
| DEEN | 1.03 | 976.99 | 16.72 |
Appendix D Few-shot, in-context learning
D.1 GPT 4 prompt
GPT 4 accessed on April 27, 2023. Prompt was repeated 20 times to generate additional samples for statistics.
Prompt: You are an expert antibody engineer. I am going to give you examples of CDR H3 variants of trastuzumab that were reported binders to the HER2 antigen in the paper "Optimization of therapeutic antibodies by predicting antigen specificity from antibody sequence via deep learning". You will generate 100 new CDR H3 variants that you predict will also bind to HER2. Output the 100 samples as a python list. Here are the examples: [’WHINGFYVFH’, ’FQDHGMYQHV’, ’YLAFGFYVFL’, ’WLNYHSYLFN’, ’YNRYGFYVFD’, ’WRKSGFYTFD’, ’WANRSFYAND’, ’WPSCGMFALL’, ’WSNYGMFVFS’, ’WSMGGFYVFV’, ’WGQLGFYAYA’, ’WPILGLYVFI’, ’WHRNGMYAFD’, ’WPLYSMYVYK’, ’WGLCGLYAYQ’,]
Response: As an AI language model, I can’t run simulations or generate sequences based on actual molecular interactions. However, I can use patterns found in your provided list to generate new sequences that may resemble the CDR H3 variants you’ve shared. Keep in mind that these new sequences have not been validated experimentally and may not bind to HER2.
D.2 GPT 3.5 prompt
GPT 3.5 accessed on May 2, 2023. Prompt was repeated 5 times to generate additional samples for statistics.
Prompt: You are an expert antibody engineer. I am going to give you examples of antibody heavy chain variable regions from the paired observed antibody space database. You will generate 10 new antibody heavy chains that are not in the database. Output the 10 samples as a python list. Here are the examples: [’QLQLQESGPGLVKPSGTLSLICAVAGSSVTTSNVYWDWIRQPPGKGLEWIGTISYSATT’, ’YYNPSLKSRVTLFVDTSKNQFSLKLNSVTAADTAMYYCARHVVDCTGGRCLWKTGFDYWGQGTLVTVSS’, ’QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYY’, ’ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDQGLSTYYGYDKDSSYGMDVWGQGTTVTVSS’, ’EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYY’, ’ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDFGYCSGGSCSGWGQGTLVTVSS’, ’QVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVHWVRQPPGKGLEWMGVMWSDGDTSYN’, ’SALKSRLSISRDTSKSQVFLKMSSLQTEDTATYYCARSGKAVMDAWGQGASVTVSS’, ’QVQLVQSGAEVKKPGSSVKVSCKASGGPFRGSTINWVRQAPGQGLEWMGRIIPILNAPNY’, ’AQNFHGRVTITADKSTSTAYMELSSLTSDDTALYFCATYSGTYHMAPGAFDIWGHGTMVTVSS’]
Response: Sure, I can help you generate 10 new antibody heavy chains. Here’s a list of 10 new antibody heavy chains that are not in the given database: …
These heavy chains were generated using the antibody engineering tools and techniques to create novel heavy chains. The generated sequences have a similar length and structure as the provided examples, but they have different amino acid sequences, and are unique.
Appendix E in vitro validation
E.1 Experimental details
in vitro validation of generated antibody proteins was performed following Hsiao et al. (2020). Discrete Walk-Jump Sampling (dWJS) and SeqVDM were used to generate antibody sequences, which were then expressed and purified in the laboratory. Surface plasmon resonance (SPR) measurements were used to determine binding affinity.